Recombinant Branchiostoma lanceolatum ATP synthase subunit a (ATP6)

Shipped with Ice Packs
In Stock

Description

Introduction to ATP Synthase and Subunit a

ATP synthase, a critical enzyme in oxidative phosphorylation, generates ATP by coupling proton translocation across mitochondrial membranes to ADP phosphorylation. The ATP6 gene encodes subunit a, a core component of the F₀ sector of ATP synthase. This subunit forms part of the proton channel alongside oligomeric subunit c, enabling proton flow and driving ATP synthesis . In Branchiostoma lanceolatum (a cephalochordate model organism), ATP6 is highly conserved, sharing structural and functional homology with human and yeast orthologs .

Mutation Analysis

Studies on yeast ATP6 homologs reveal how conserved residues influence proton dynamics:

  • First-Site Reversions: Reverting aR173 to leucine (e.g., aL173M, aL173S) restores partial ATP synthesis, suggesting compensatory electrostatic interactions .

  • Second-Site Reversions: Mutations at aR169 or aA170 (e.g., aR169S, aA170P) further stabilize proton release pathways .

Genetic Studies in Branchiostoma

Whole-genome and mitochondrial resequencing of Branchiostoma belcheri and lanceolatum identified:

Mutation TypeEffect on FunctionSource
mt-tRNA-LysDisrupts oxidative phosphorylation protein assembly
ATP6 nsSNPsRare variants (MAF < 0.05) alter intracellular digestion capacity

These studies highlight ATP6’s role in mitochondrial energy production and its evolutionary conservation .

Comparative Analysis with Other ATP6 Orthologs

OrganismKey FeaturesConservation
HumanaL156R mutation linked to NARP (neuropathy, ataxia, retinitis pigmentosa)Strictly conserved residues
YeastaL173R mutation reduces ATP synthesis to 10% of wild-type levelsStructural homology
BranchiostomaFull-length recombinant protein retains functional proton channel motifsSequence identity ~85%

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
ATP6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Branchiostoma lanceolatum (Common lancelet) (Amphioxus lanceolatum)
Target Names
ATP6
Target Protein Sequence
MMVSLFSQFDSPWLLNIPLVLLALIMPWKLFVSFGPSWAGTRSSRLVYVTMETLMSQVMQ PLNKLGFRWVVLFSSLMLMLMTLNVIGLFPYTFTPTTQLSMNLGLAVPLWFGTVVYGFRN HPVIALAHLCPEGAPNLLVPVLVVVETLSILMRPLALGLRLTANLTAGHLLMHLISSAVL GLMELSVMLSGITLLLLVFLTMLEIAVALIQGYVFAILVTLYLDENL
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F1F0 ATP synthase or Complex V) synthesizes ATP from ADP using the proton gradient across the mitochondrial membrane, generated by the respiratory chain's electron transport complexes. F-type ATPases comprise two domains: the extramembraneous catalytic F1 domain and the membrane-bound proton channel F0 domain, connected by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. Subunit a is a key component of the proton channel and may directly participate in proton translocation across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of studying ATP6 in Branchiostoma lanceolatum?

Branchiostoma (amphioxus) occupies a critical phylogenetic position as a cephalochordate, providing insights into early chordate evolution. Studies have demonstrated that the mitochondrial genome organization in Branchiostoma is identical to that of humans, making it valuable for evolutionary studies . The ATP6 protein forms a crucial part of ATP synthase, specifically one subunit of the large enzyme complex that performs the final step of oxidative phosphorylation in mitochondria . By studying recombinant Branchiostoma lanceolatum ATP6, researchers can investigate the evolutionary conservation of this essential bioenergetic machinery across chordates and gain insights into fundamental aspects of mitochondrial function that preceded vertebrate evolution.

How does ATP6 structure and function in Branchiostoma compare to its human counterpart?

ATP6 (also called subunit a) in both Branchiostoma and humans is a critical component of the Fo portion of the ATP synthase complex. In functional terms, ATP6 contributes to the formation of the proton channel within the membrane-embedded portion of ATP synthase. The proton motive force drives the Fo motor when protons enter the half-channel of the membrane-embedded a subunit from the intermembrane space and move along horizontally tilted helices .

The high conservation of this structure across species suggests similar mechanistic principles, though species-specific variations exist. In Branchiostoma, as in other organisms, ATP6 contains transmembrane domains that form part of the proton pathway essential for ATP synthesis. Mutations in this protein can significantly impact oxidative phosphorylation efficiency, as seen in both experimental models and human mitochondrial disorders .

What are the conserved domains and critical residues in Branchiostoma lanceolatum ATP6?

ATP6 contains several highly conserved residues that form the proton channel alongside the c-subunit ring. While specific Branchiostoma lanceolatum data is limited in the current literature, research on ATP synthase across species indicates that certain amino acids in ATP6 are essential for:

  • Proton translocation: Residues that form the half-channels for proton entry and exit

  • Interaction with c-subunits: Interface residues that enable rotation of the c-ring

  • Structural integrity: Residues important for proper folding and membrane insertion

Mutations affecting these functional domains can alter enzyme kinetics, potentially changing both Vmax and KM parameters, as observed in studies of ATP synthase inhibition . Research specifically mapping these domains in Branchiostoma would provide valuable comparative data for evolutionary bioenergetics studies.

What are the optimal expression systems for producing recombinant Branchiostoma lanceolatum ATP6?

Expression of recombinant mitochondrial membrane proteins presents significant challenges due to their hydrophobicity and the requirement for proper membrane insertion. For Branchiostoma lanceolatum ATP6, researchers should consider:

The choice depends on the research questions being addressed. For structural studies requiring large amounts of protein, bacterial systems with subsequent refolding might be sufficient. For functional studies, yeast or mammalian systems that better preserve native conformation would be preferable.

How can heteroplasmy be modeled when studying ATP6 variants in Branchiostoma models?

Heteroplasmy—the presence of multiple mitochondrial DNA (mtDNA) variants within a cell or tissue—presents particular challenges when studying ATP6 variants. Based on research in human MT-ATP6 variants, several approaches can be adapted for Branchiostoma studies:

  • Quantitative measurement: Utilize techniques such as pyrosequencing, digital droplet PCR, or next-generation sequencing to accurately determine heteroplasmy levels. Recent studies have shown that difference in mutant heteroplasmy levels between different tissues (blood, urinary epithelial cells, and buccal mucosal cells) is typically <10% for most MT-ATP6 variants .

  • Tissue selection considerations: Research has demonstrated that heteroplasmy levels do not always clearly correlate with disease severity in mitochondrial diseases . When designing experiments with Branchiostoma ATP6 variants, multiple tissue types should be assessed.

  • Threshold effect modeling: Studies have shown that certain MT-ATP6 variants may appear asymptomatic despite high heteroplasmy levels . When investigating Branchiostoma ATP6 variants, researchers should establish variant-specific thresholds for functional effects rather than assuming linear relationships between heteroplasmy and phenotype.

This approach allows more accurate modeling of the complex relationship between ATP6 variant load and functional consequences in experimental systems.

What techniques are most effective for assessing ATP synthase activity in systems expressing recombinant Branchiostoma ATP6?

When measuring ATP synthase activity in systems with recombinant Branchiostoma ATP6, multiple complementary approaches should be considered:

  • Biochemical assays:

    • ATP synthesis rate measurements in isolated mitochondria or submitochondrial particles

    • ATP hydrolysis assays using isolated enzyme or membrane preparations

    • Spectrophotometric assays coupling ATP production/hydrolysis to NADH oxidation

  • Biophysical techniques:

    • Blue Native PAGE (BN-PAGE) to assess ATP synthase complex assembly and quantity

    • Förster Resonance Energy Transfer (FRET) for studying structural dynamics

    • Membrane potential measurements using fluorescent probes

  • Advanced microscopy:

    • Super-resolution techniques like Structured Illumination Microscopy (SIM) or Stimulated Emission Depletion (STED) microscopy to visualize cristae morphology and ATP synthase organization

    • Single-molecule FRET between fluorophores attached to rotor and stator components to directly observe rotary dynamics

For most comprehensive assessment, researchers should combine functional assays (measuring ATP production/hydrolysis rates) with structural analyses (assessing proper complex assembly) to fully characterize the impact of their recombinant ATP6 on ATP synthase function.

How do mutations in Branchiostoma ATP6 compare to pathogenic human MT-ATP6 variants?

Human MT-ATP6 mutations are associated with a spectrum of disorders including Leigh syndrome, NARP (Neurogenic muscle weakness, Ataxia, and Retinitis Pigmentosa), Charcot-Marie-Tooth disease-like peripheral neuropathy, and spinocerebellar ataxia . While specific Branchiostoma ATP6 mutations have not been extensively characterized, the high conservation of mitochondrial function suggests several parallels:

  • Functional domains: Mutations affecting proton channel formation would likely disrupt ATP synthesis in both species. The m.8993T>G/C mutations in humans affect a highly conserved leucine residue critical for proton translocation .

  • Assembly effects: Some ATP6 mutations may disrupt proper assembly of the ATP synthase complex. Studies in yeast have shown that certain subunit 6 variants exhibit enhanced translation when assembly is defective, suggesting compensatory mechanisms that might be conserved across species .

  • Heteroplasmy effects: In humans, the phenotypic expression of MT-ATP6 mutations is strongly influenced by heteroplasmy levels, though this relationship is not always linear . Similar heteroplasmy threshold effects would be expected in any model system using Branchiostoma ATP6 variants.

A systematic mutagenesis approach targeting conserved residues in Branchiostoma ATP6 would provide valuable comparative data for understanding the functional consequences of mutations across species.

What are effective strategies for site-directed mutagenesis of recombinant Branchiostoma ATP6?

When introducing specific mutations into Branchiostoma ATP6, researchers should consider:

  • Targeting conserved residues: Prioritize residues known to be functionally important across species, particularly those:

    • Involved in proton translocation

    • Located at interfaces with other subunits

    • Associated with human disease when mutated

  • Mutagenesis approaches:

    • For recombinant expression constructs, standard site-directed mutagenesis protocols can be employed

    • For studies in the native mitochondrial context, mitochondria-targeted nucleases (like mitoTALENs or mitochondrially-targeted CRISPR systems) may be required

  • Mutation validation strategies:

    • Sequencing to confirm the intended mutation

    • Translation rate analysis, as some ATP6 variants show accelerated translation when assembly is defective

    • Protein stability and complex assembly assessment using BN-PAGE

  • Heteroplasmy considerations:

    • Develop methods to control the ratio of wild-type to mutant ATP6 when studying heteroplasmic effects

    • Quantify heteroplasmy levels precisely, as the correlation between heteroplasmy and phenotype is not always straightforward

How can researchers interpret contradictory results when studying ATP6 variants?

The study of ATP6 variants often produces seemingly contradictory results due to complex threshold effects, tissue-specific manifestations, and interactions with other genetic factors. Based on human MT-ATP6 variant studies, researchers should:

How can researchers effectively study the interaction between recombinant Branchiostoma ATP6 and other ATP synthase subunits?

Understanding the interactions between ATP6 and other subunits is crucial for comprehending ATP synthase assembly and function. Recommended approaches include:

  • Co-immunoprecipitation studies: Using tagged versions of ATP6 to pull down interacting partners.

  • Crosslinking experiments: Employing chemical crosslinkers to capture transient interactions during assembly.

  • FRET-based interaction analysis: Tagging ATP6 and potential interacting partners with appropriate fluorophores to detect proximity in living cells or isolated mitochondria. This approach was used successfully to study interactions between FoF1-ATP synthase components .

  • Assembly intermediate characterization: Analyzing the composition of assembly intermediates in systems with ATP6 variants or when ATP6 is absent. Research has shown that translation of ATP6 is regulated by assembly intermediates interacting with these proteins within the final ATP synthase .

  • Structural studies: Employing cryo-electron microscopy to visualize ATP6 integration within the larger complex, similar to studies that have revealed binding sites and conformational changes in mitochondrial ATP synthase components .

These approaches can reveal how ATP6 contributes to proton channel formation, how it interacts with the rotating c-ring, and how mutations disrupt these critical interactions.

What are the best methods for monitoring the incorporation of recombinant Branchiostoma ATP6 into functional ATP synthase complexes?

To track the incorporation of recombinant Branchiostoma ATP6 into functional ATP synthase complexes, researchers can employ several complementary techniques:

  • Blue Native PAGE analysis: This technique allows visualization of assembled complexes and can reveal both fully assembled ATP synthase and assembly intermediates. A clear decrease in assembled ATP synthase was detected using BN-PAGE in a patient harboring an MT-ATP6 insertion .

  • Immunodetection with subunit-specific antibodies: Western blotting after BN-PAGE can confirm the presence of specific subunits within complexes.

  • Pulse-chase experiments: These can track the kinetics of ATP6 incorporation into larger complexes over time.

  • Fluorescence microscopy with tagged ATP6: This approach allows visualization of localization and potentially assembly status in living cells.

  • Functional assays: Measuring ATP synthesis capacity in systems expressing recombinant ATP6 provides evidence of functional incorporation.

  • Translation rate analysis: Monitoring translation rates can provide insights into assembly status, as research has shown that translation of ATP6 is enhanced in mutant strains with specific assembly defects .

A combination of these approaches provides the most comprehensive assessment of ATP6 incorporation and function within the ATP synthase complex.

What are the most promising approaches for using recombinant Branchiostoma ATP6 in structural studies?

Structural studies of membrane proteins like ATP6 present significant challenges. For recombinant Branchiostoma ATP6, consider:

  • Cryo-electron microscopy (cryo-EM): This has become the method of choice for membrane protein structures, particularly large complexes like ATP synthase. Recent high-resolution cryo-EM structures of mitochondrial ATP synthase from bovine heart and yeast have provided detailed views of subunit interactions and binding sites .

  • X-ray crystallography: While challenging for membrane proteins, this approach might be successful with fusion constructs or antibody fragment complexes to aid crystallization.

  • NMR spectroscopy: For specific domains or in combination with other techniques. NMR has been successfully used to study binding sites on ATP synthase subunits, such as identifying the binding site of Bz-423 on the OSCP subunit .

  • Molecular dynamics simulations: To model dynamic aspects of ATP6 function within membranes, particularly proton translocation pathways.

  • Single-particle electron microscopy: For analyzing ATP6 in the context of the full ATP synthase complex or sub-complexes.

These approaches can reveal critical structural features that underlie ATP6 function and provide templates for understanding the impact of mutations.

How can researchers effectively label recombinant Branchiostoma ATP6 for imaging studies?

Labeling ATP6 for imaging studies requires strategies that maintain protein function while providing detectable signals. Based on studies with other ATP synthase components, consider:

  • Genetic fusion approaches: Creating fusion proteins with fluorescent proteins like GFP. A yeast-enhanced green fluorescent protein (yEGFP) linked to the C-terminus of the γ subunit has been used successfully for FRET imaging of ATP synthase .

  • Site-specific labeling: Using unnatural amino acid incorporation or enzymatic tags (SNAP-tag, Halo-tag) for attachment of small molecule fluorophores at specific sites.

  • Minimally disruptive tags: Employing small epitope tags that can be detected with fluorescent antibodies or probes after fixation.

  • Considerations for membrane topology: Ensuring labels are positioned to not disrupt membrane insertion or interactions with other subunits.

  • Verification of functionality: Confirming that labeled ATP6 maintains proper assembly and ATP synthase function through activity assays.

For advanced imaging, super-resolution microscopy approaches like SIM or STED microscopy can be employed to visualize ATP synthase organization within mitochondrial cristae , particularly important when studying the effects of ATP6 variants on mitochondrial ultrastructure.

Table 1: Comparison of ATP6 Functional Domains Across Species

Functional DomainBranchiostoma lanceolatumHumanYeastFunction
Proton channel residuesConserved, specific residues to be determinedContains critical residues including L156 (affected in m.8993T>G/C mutations)Contains homologous residues to humanFacilitates proton translocation
c-ring interfaceHighly conservedInteracts with c-subunit ringInteracts with c-subunit ringEnables coupling of proton flow to rotation
Membrane-spanning regionsMultiple transmembrane domains5-6 transmembrane helices5-6 transmembrane helicesAnchors protein in inner mitochondrial membrane
Assembly interfacesInteraction with other Fo subunitsInteractions with other Fo componentsRegulated by assembly-dependent feedbackEnsures proper complex formation

Table 2: Comparison of Heteroplasmy Effects in MT-ATP6 Variants Based on Human Studies

VariantHeteroplasmy Range in Affected IndividualsHeteroplasmy Range in Unaffected CarriersThreshold for Clinical ExpressionReference
m.8993T>G70-100%<60%~60-70%
m.8993T>C80-100%<70%~70-80%
m.9185T>CVariableVariableUnclear, overlapping ranges
MT-ATP6 variants (general)Mean 95%Mean 73%Variable by specific variant

What are the most promising future directions for Branchiostoma ATP6 research?

Branchiostoma ATP6 research offers several promising avenues for future investigation:

  • Evolutionary insights: Comparative studies between Branchiostoma ATP6 and its homologs in other species can illuminate the evolution of mitochondrial ATP synthesis mechanisms.

  • Disease modeling: As a model for understanding human mitochondrial disorders caused by MT-ATP6 mutations, Branchiostoma systems could provide valuable insights into pathogenic mechanisms.

  • Structural biology: High-resolution structures of Branchiostoma ATP synthase, with focus on the ATP6 component, would enhance understanding of proton translocation mechanisms.

  • Bioengineering applications: Engineered variants with altered properties could serve as tools for understanding bioenergetics or developing novel biotechnological applications.

  • Biophysical studies: Single-molecule approaches to directly visualize ATP6 function within the rotary ATP synthase motor could resolve long-standing questions about the details of proton-driven rotation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.