Recombinant Branchiostoma lanceolatum NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Description

Introduction to Branchiostoma lanceolatum

Branchiostoma lanceolatum, commonly known as the Mediterranean amphioxus or lancelet, represents a critical taxon in evolutionary biology due to its position as a basal chordate. This organism belongs to the subphylum Cephalochordata and serves as an important evolutionary link between invertebrates and vertebrates.

The scientific significance of Branchiostoma lanceolatum extends beyond its evolutionary position, as it has become an important model organism for studying the evolution of various biological systems. The species has been extensively studied alongside other amphioxus species, including Branchiostoma belcheri (Asian amphioxus), Branchiostoma japonicum (Asian amphioxus), and Branchiostoma floridae (Florida amphioxus) . These comparative studies have yielded valuable insights into the evolutionary development of chordate characteristics.

Branchiostoma lanceolatum possesses several key biological features that have made it valuable for research, including a notochord, dorsal hollow nerve cord, pharyngeal gill slits, and segmented musculature. These features, combined with its relatively simple genome compared to vertebrates, make proteins derived from this organism particularly useful for understanding the evolution of fundamental cellular components such as mitochondrial respiratory complexes.

NADH-ubiquinone oxidoreductase: Functional Significance

NADH-ubiquinone oxidoreductase, also known as Complex I of the mitochondrial respiratory chain, plays a crucial role in cellular energy metabolism. As one of the largest enzyme complexes in the inner mitochondrial membrane, it catalyzes the first step in the electron transport chain during oxidative phosphorylation.

The primary function of this enzyme complex is to transfer electrons from NADH to ubiquinone (Coenzyme Q), coupled with the translocation of protons across the inner mitochondrial membrane. This process contributes to the establishment of the proton gradient that drives ATP synthesis. The enzyme is classified with the Enzyme Commission number 1.6.5.3, denoting its role as an oxidoreductase acting on NADH with ubiquinone as an electron acceptor .

The general reaction catalyzed by NADH-ubiquinone oxidoreductase can be represented as:

NADH + H⁺ + Ubiquinone + 4H⁺(matrix) → NAD⁺ + Ubiquinol + 4H⁺(intermembrane space)

Complex I typically consists of multiple subunits, with the exact composition varying across species. In many organisms, several core subunits, including ND3, are encoded by mitochondrial DNA, while accessory subunits are encoded by nuclear DNA. The ND3 subunit specifically contributes to the membrane-embedded domain of Complex I and participates in the proton translocation machinery.

Production and Purification Methods

The recombinant Branchiostoma lanceolatum ND3 protein is produced using Escherichia coli as the expression host . E. coli represents one of the most widely used expression systems for recombinant protein production due to its rapid growth rate, well-characterized genetics, and relatively simple cultivation requirements.

Following expression, the protein undergoes purification processes to remove host cell proteins and other contaminants. The final product achieves a purity level exceeding 85% as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) . This high level of purity ensures that the recombinant protein is suitable for sensitive research applications.

Table 2: Production and Purification Specifications

ParameterSpecification
Expression SystemE. coli
Purity>85% (SDS-PAGE)
Immunogen SpeciesBranchiostoma lanceolatum (Common lancelet)
SourceE. coli

The partial nature of the protein sequence may reflect deliberate design choices to enhance expression efficiency or solubility, as full-length membrane proteins often prove challenging to express in bacterial systems. Alternatively, it may represent a naturally occurring variant or a truncated form that retains key functional domains.

Research Applications and Significance

Recombinant Branchiostoma lanceolatum ND3 protein offers significant value across multiple research domains, particularly in evolutionary biology, comparative biochemistry, and mitochondrial research. As a component from a basal chordate organism, this protein provides a unique perspective on the evolution of mitochondrial respiratory complexes.

In evolutionary biology, the protein serves as a molecular tool for investigating the conservation and divergence of mitochondrial components across the chordate lineage. Branchiostoma lanceolatum occupies a critical position in the evolutionary tree, representing an early branch point in chordate evolution. Studying its mitochondrial proteins helps elucidate the ancestral state of these essential components before the divergence of vertebrates.

The protein's designation as an immunogen suggests its utility in antibody production . Such antibodies can facilitate detection, localization, and functional studies of the native protein in Branchiostoma lanceolatum tissues. These immunological tools extend the research applications beyond biochemical characterization to cellular and tissue-level investigations.

In comparative biochemistry, this recombinant protein enables structural and functional comparisons with homologous proteins from other species. Such comparative analyses can reveal conserved functional domains, species-specific adaptations, and evolutionary constraints that have shaped these proteins over time.

The availability of a computed structure model for this protein, as indicated in search result , suggests that structural studies have been conducted or are feasible. Structural information enhances understanding of protein function and enables more targeted experimental approaches for functional characterization.

Potential research applications include:

  1. Generation of specific antibodies for immunodetection and localization studies

  2. Structural analyses through techniques such as X-ray crystallography or cryo-electron microscopy

  3. Functional reconstitution studies to assess enzymatic activity

  4. Protein-protein interaction studies to understand complex assembly

  5. Evolutionary comparisons with homologous proteins from other species

Comparative Analysis with Related Proteins

While the search results provide limited information for direct comparison between ND3 and other NADH-ubiquinone oxidoreductase subunits from Branchiostoma lanceolatum, it is worth noting that NADH-ubiquinone oxidoreductase chain 6 (ND6) from the same organism has also been produced as a recombinant protein .

NADH-ubiquinone oxidoreductase chain 6 (ND6) is another mitochondrially encoded subunit of Complex I, identified by UniProt accession number P69233 . Like ND3, it is part of the membrane domain of the complex and contributes to the proton-pumping machinery. The availability of both ND3 and ND6 as recombinant proteins facilitates comparative studies of different components from the same respiratory complex.

Table 4: Comparison of Recombinant ND3 and ND6 from Branchiostoma lanceolatum

FeatureND3ND6
UniProt AccessionP69237P69233
Protein NameNADH-ubiquinone oxidoreductase chain 3NADH-ubiquinone oxidoreductase chain 6
Alternative NameNADH dehydrogenase subunit 3NADH dehydrogenase subunit 6
OrganismBranchiostoma lanceolatumBranchiostoma lanceolatum
Expression SystemE. coliNot specified in search results

In the broader context of NADH-ubiquinone oxidoreductase research, these recombinant proteins from Branchiostoma lanceolatum contribute to understanding the evolution of mitochondrial respiratory complexes. The availability of multiple subunits enables more comprehensive studies of Complex I structure, assembly, and function in this evolutionarily significant organism.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is established during production. If you have a specific tag preference, please communicate it to us, and we will strive to incorporate it.
Synonyms
ND3; NAD3; NADH3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-117
Protein Length
full length protein
Species
Branchiostoma lanceolatum (Common lancelet) (Amphioxus lanceolatum)
Target Names
ND3
Target Protein Sequence
MLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVA ILFLLFDLEIALILPYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLKGGLEWTE
Uniprot No.

Target Background

Function
Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to be essential for the minimal assembly required for catalysis. Complex I plays a vital role in transferring electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is thought to be ubiquinone.
Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

How does B. lanceolatum ND3 compare to homologous proteins in other species?

Comparative analysis of ND3 sequences demonstrates remarkable conservation between B. lanceolatum and other amphioxus species, particularly B. floridae. Both species share identical amino acid sequences for ND3 , suggesting strong evolutionary constraint on this protein. The conservation extends to the full 117-amino acid sequence:

SpeciesND3 Sequence
B. lanceolatumMLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLKGGLEWTE
B. floridaeMLSLTYIVGIASALVIILLLVGLHLPSVMPDNEKLSAYECGFDPMGNARLPFSLRFFLVAILFLLFDLEIALILPYPLGVVFSENTFYNYWLVMLLVVVLTFGLMYEWLKGGLEWTE

This perfect conservation between species that diverged millions of years ago indicates the critical functional importance of this protein in mitochondrial energy metabolism. In contrast, when compared to vertebrate ND3 proteins, there are more sequence variations, though the core functional domains remain conserved. These evolutionary patterns provide insights into the ancestral state of mitochondrial function before the emergence of vertebrates .

What is the significance of studying amphioxus ND3 in evolutionary research?

Amphioxus occupies a unique position in chordate phylogeny as a basal lineage that diverged before the origin of vertebrates. As such, B. lanceolatum provides a window into the ancestral state of chordate genes and proteins . Studying ND3 in this organism offers several advantages:

  • Insights into mitochondrial evolution: Comparing amphioxus ND3 with vertebrate homologs can reveal how mitochondrial function has evolved in the chordate lineage.

  • Understanding conservation mechanisms: The high conservation of ND3 sequence between amphioxus species suggests strong purifying selection, providing opportunities to study evolutionary constraints on mitochondrial proteins.

  • Reconstructing ancestral states: As a basal chordate, amphioxus ND3 can help reconstruct the ancestral state of this protein in the common ancestor of all chordates.

  • Linking structure to function: Comparative studies can reveal which structural features have been conserved across evolution and are therefore likely critical for function.

Research on B. lanceolatum has been facilitated by recent advancements in genomic resources, including the high-quality BraLan3 genome assembly containing 27,102 protein-coding genes with 96.97% located on chromosomes .

What are optimal methods for expressing recombinant B. lanceolatum ND3?

Expressing functional recombinant B. lanceolatum ND3 requires careful consideration of multiple factors due to its nature as a transmembrane protein. Based on established protocols, the following methodological approach is recommended:

Expression System Selection:

E. coli is the most commonly used expression system for recombinant B. lanceolatum ND3 . Specifically, specialized strains designed for membrane protein expression, such as C41(DE3) or C43(DE3), often yield better results than standard BL21(DE3) strains.

Vector Design Considerations:

The expression construct should include:

  • An N-terminal tag (typically a His-tag) for purification

  • A promoter with inducible expression (T7 promoter systems are common)

  • Appropriate signal sequences if targeting to membranes is desired

Optimization Parameters:

ParameterRecommended ConditionsNotes
Temperature16-22°CLower temperatures reduce inclusion body formation
Induction0.1-0.5 mM IPTGHigher concentrations may not improve yield
Media2XYT or TB with glycerolRich media improves membrane protein yield
Duration16-24 hoursExtended induction at lower temperatures
Additives5-10% glycerolStabilizes membrane proteins

For extraction, specialized detergents are typically required to solubilize membrane proteins. The choice of detergent should be optimized based on downstream applications and stability requirements .

How can researchers verify the functionality of recombinant B. lanceolatum ND3?

Verifying the functionality of recombinant ND3 requires multiple complementary approaches:

Structural Integrity Assessment:

  • SDS-PAGE to confirm protein size and purity (>85% purity is typically achievable)

  • Circular dichroism spectroscopy to assess secondary structure content

  • Size exclusion chromatography to evaluate oligomeric state and aggregation

Enzymatic Activity Assays:

  • NADH:ubiquinone oxidoreductase activity measurement using isolated recombinant protein

  • Electron transfer rate determination using artificial electron acceptors

  • Proton pumping assays using reconstituted proteoliposomes

Integration into Complex I:

  • Reconstitution assays with other Complex I subunits

  • Complementation studies in model systems with defective Complex I

  • Blue Native PAGE to assess integration into larger complexes

Spectroscopic Analysis:

  • EPR spectroscopy to examine redox centers

  • FTIR spectroscopy to evaluate structural features in membrane environments

  • Fluorescence spectroscopy using intrinsic tryptophan fluorescence or labeled protein

When interpreting these assays, researchers should consider that ND3's native environment is within the larger Complex I structure, and isolated function may differ from its behavior in the intact complex.

What challenges are specific to working with recombinant amphioxus mitochondrial proteins?

Working with recombinant amphioxus ND3 presents several unique challenges that researchers should anticipate:

Membrane Protein Expression Issues:

Mitochondrial membrane proteins like ND3 often express poorly in heterologous systems, with common problems including:

  • Protein misfolding and aggregation

  • Toxicity to host cells

  • Sequestration in inclusion bodies

  • Improper insertion into membranes

Reconstruction of Native Environment:

ND3 functions as part of Complex I, which presents challenges for functional studies:

  • Difficulty reconstituting the complete Complex I in vitro

  • Altered function when studied in isolation

  • Requirements for specific lipid compositions

Species-Specific Considerations:

  • Limited availability of amphioxus-specific research tools and antibodies

  • Genetic code variations in mitochondrial genes between species

  • Differences in post-translational modifications between expression systems and native environment

Stability and Storage:

Recombinant ND3 typically requires specialized storage conditions:

  • Storage at -20°C or -80°C for extended periods

  • Addition of glycerol (typically 50%) as a cryoprotectant

  • Avoiding repeated freeze-thaw cycles

  • Limited shelf life (typically 6 months for liquid form, 12 months for lyophilized form)

These challenges necessitate careful optimization and validation at each step of the experimental process.

What controls are essential when working with recombinant B. lanceolatum ND3?

Robust experimental design requires appropriate controls to ensure valid interpretations of results. When working with recombinant B. lanceolatum ND3, researchers should implement the following controls:

Expression and Purification Controls:

  • Empty vector control: Cells transformed with expression vector lacking the ND3 gene

  • Tag-only control: Expression of the tag sequence without ND3

  • Purification background control: Mock purification from non-transformed cells

Protein Quality Controls:

  • SDS-PAGE analysis to verify size and purity (>85% purity standard)

  • Western blot with anti-His antibodies (for His-tagged constructs)

  • Mass spectrometry to confirm protein identity and detect potential modifications

Functional Assays Controls:

  • Positive control: Commercial or well-characterized mitochondrial proteins

  • Negative control: Heat-denatured ND3 sample

  • Inhibitor control: Specific Complex I inhibitors (e.g., rotenone)

Species Comparison Controls:

  • Parallel experiments with B. floridae ND3 (identical sequence but different source)

  • Where available, comparison with vertebrate ND3 to identify conserved functions

Environmental Controls:

  • Buffer composition controls (e.g., with/without specific ions)

  • Membrane/detergent composition controls

  • Redox state controls

Careful implementation of these controls allows researchers to distinguish specific effects related to B. lanceolatum ND3 from artifacts or non-specific effects.

How should researchers approach comparative studies between amphioxus and vertebrate ND3?

Comparative studies between amphioxus and vertebrate ND3 require careful experimental design to yield meaningful evolutionary insights:

Sequence-Based Comparative Approach:

  • Perform comprehensive phylogenetic analysis including multiple chordate species

  • Identify conserved domains and residues across lineages

  • Map functional domains to sequence alignments

  • Analyze selection patterns (dN/dS ratios) to identify regions under purifying or positive selection

Structural Comparison Methodology:

  • Generate structural models of both amphioxus and vertebrate ND3

  • Compare predicted transmembrane regions and functional domains

  • Identify structural differences that might relate to functional divergence

  • Use molecular dynamics simulations to analyze potential differences in protein dynamics

Functional Comparison Strategy:

  • Express recombinant proteins from multiple species under identical conditions

  • Perform parallel functional assays using standardized protocols

  • Measure kinetic parameters to quantify functional differences

  • Test function under varying physiological conditions (pH, temperature, ion concentrations)

Integration with Complex I Studies:

When interpreting results, researchers should consider the evolutionary distance between amphioxus and vertebrates (~550 million years of independent evolution) and the potential for both conserved ancestral functions and lineage-specific adaptations.

How can researchers optimize the stability and activity of recombinant ND3 for functional studies?

Optimizing the stability and activity of recombinant B. lanceolatum ND3 requires addressing several key factors:

Buffer Optimization:

ComponentRecommended RangePurpose
pH7.0-8.0Maintain native protein conformation
Salt100-300 mM NaClProvide ionic strength without destabilization
Glycerol5-50%Prevent aggregation and improve stability
Reducing agent1-5 mM DTT or β-MEMaintain redox state of cysteines
DetergentMild non-ionic (e.g., DDM)Solubilize without denaturing

Stability Enhancement Strategies:

  • Addition of lipids that mimic the native mitochondrial membrane environment

  • Co-expression or reconstitution with interacting partners from Complex I

  • Identification and mutation of unstable regions based on computational prediction

  • Addition of specific stabilizing ligands or substrates

  • Use of nanodiscs or amphipols for membrane protein stabilization

Activity Preservation Methods:

  • Maintaining physiologically relevant pH and ion concentrations

  • Inclusion of required cofactors (NADH, Fe-S cluster precursors)

  • Prevention of oxidation through anaerobic handling where appropriate

  • Optimization of protein concentration to prevent aggregation

  • Temperature control during purification and storage

Storage and Handling:

  • Aliquoting to avoid repeated freeze-thaw cycles

  • Storage at -20°C for short-term or -80°C for long-term preservation

  • Use of cryoprotectants (typically 50% glycerol)

  • Working with aliquots at 4°C for up to one week

  • Optimization of thawing conditions to minimize denaturation

By systematically addressing these factors, researchers can maximize both the stability and functional activity of recombinant B. lanceolatum ND3 for downstream applications.

How should researchers interpret functional differences between recombinant and native ND3?

Interpreting functional differences between recombinant and native ND3 requires careful consideration of multiple factors:

Source of Potential Differences:

  • Expression system artifacts (E. coli vs. mitochondrial expression)

  • Missing post-translational modifications in recombinant systems

  • Absence of native interacting partners in isolated recombinant protein

  • Alterations in protein folding or membrane insertion

  • Effects of purification tags on protein function

Methodological Approach to Interpretation:

  • Quantify the magnitude of functional differences using standardized assays

  • Test multiple functional parameters rather than relying on a single metric

  • Validate findings using complementary techniques

  • Consider concentration-dependent effects and ensure comparable protein amounts

  • Evaluate whether differences affect all functional aspects or only specific parameters

Analytical Framework:

  • Develop structure-function hypotheses that could explain observed differences

  • Use site-directed mutagenesis to test whether specific regions contribute to functional differences

  • Employ computational modeling to predict structural implications of expression differences

  • Consider evolutionary context when interpreting functional variations

Reconciliation Strategies:

  • Express protein in eukaryotic systems to better approximate native conditions

  • Reconstitute with purified Complex I components to restore native interactions

  • Remove affinity tags after purification if they affect function

  • Optimize membrane environment to better mimic native mitochondrial membranes

Understanding these differences is not merely a technical consideration but can provide insights into the factors that regulate ND3 function in vivo.

What approaches can resolve contradictory results in studies of amphioxus ND3?

When facing contradictory results in amphioxus ND3 studies, researchers should employ the following systematic approaches:

Methodological Standardization:

  • Compare experimental protocols in detail to identify potential sources of variation

  • Standardize key parameters across studies (expression systems, purification methods, assay conditions)

  • Exchange materials between laboratories to isolate methodology-dependent effects

  • Develop reference standards that can be used across different studies

Reconciliation Strategies:

  • Test whether contradictions are condition-dependent (e.g., pH, temperature, redox state)

  • Investigate whether protein preparation differences explain contradictory results

  • Consider whether genetic variations between amphioxus populations could contribute

  • Evaluate whether different functional assays are measuring distinct aspects of protein function

Advanced Approaches:

  • Single-molecule techniques to detect potential heterogeneity in protein behavior

  • Structural studies to identify multiple conformational states

  • Mathematical modeling to integrate apparently contradictory data into coherent frameworks

  • Collaboration between laboratories reporting contradictory results to directly compare methods

By systematically addressing contradictions, researchers can often uncover new biological insights about protein function and regulation.

How can researchers effectively integrate ND3 data into broader understanding of mitochondrial evolution?

Integrating ND3 data into broader evolutionary contexts requires multidisciplinary approaches:

Phylogenetic Integration Framework:

  • Construct comprehensive phylogenies including diverse chordate species

  • Map functional and structural changes onto evolutionary trees

  • Identify patterns of co-evolution with other mitochondrial proteins

  • Reconstruct ancestral sequences to infer evolutionary trajectories

Comparative Genomics Approach:

  • Analyze conservation patterns across multiple species

  • Examine synteny and gene order in mitochondrial genomes

  • Identify lineage-specific changes in selection pressure

  • Compare with nuclear-encoded mitochondrial proteins to detect co-evolutionary patterns

Functional Evolution Interpretation:

  • Correlate sequence/structural changes with functional differences

  • Consider physiological adaptations in different lineages

  • Evaluate functional constraints in the context of mitochondrial complex assembly

  • Examine how ND3 evolution relates to metabolic adaptations in different lineages

Integration with Broader Evolutionary Studies:

  • Connect ND3 evolution to major evolutionary transitions in chordates

  • Compare patterns observed in ND3 with other mitochondrial genes

  • Consider how ND3 evolution relates to changes in organismal complexity

  • Evaluate whether parallel evolutionary changes occur in distinct lineages

Recent genomic resources for B. lanceolatum, including the high-quality BraLan3 genome assembly , facilitate these integrative approaches by providing a comprehensive genomic context for mitochondrial gene evolution studies.

What emerging technologies hold promise for advancing amphioxus ND3 research?

Several cutting-edge technologies are likely to advance research on B. lanceolatum ND3 in the near future:

Advanced Structural Biology Techniques:

  • Cryo-electron microscopy for high-resolution structures of amphioxus Complex I

  • Integrative structural biology combining multiple data types

  • Time-resolved structural methods to capture conformational changes

  • Hydrogen-deuterium exchange mass spectrometry for dynamics studies

Genome Editing Technologies:

  • CRISPR-Cas9 approaches adapted for amphioxus to create ND3 mutations

  • Base editing for precise modification of specific residues

  • Prime editing for introducing specific mutations without double-strand breaks

  • Knock-in strategies to introduce reporter tags for in vivo studies

Single-Cell and Spatial Technologies:

  • Single-cell transcriptomics to examine cell-type specific expression patterns

  • Spatial transcriptomics to map ND3 expression in amphioxus tissues

  • Proximity labeling approaches to identify interaction partners

  • Super-resolution microscopy for localization studies

Computational Approaches:

  • Deep learning for protein structure prediction specific to membrane proteins

  • Molecular dynamics simulations at extended timescales

  • Systems biology modeling of mitochondrial function

  • Evolutionary sequence analysis using sophisticated statistical approaches

These technologies will help address fundamental questions about ND3 function, regulation, and evolution that have been challenging to approach with conventional methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.