Recombinant Branchiostoma lanceolatum NADH-ubiquinone oxidoreductase chain 6 (ND6)

Shipped with Ice Packs
In Stock

Description

Functional Role in Complex I

ND6 is one of seven mitochondrial-encoded subunits in Complex I, which catalyzes NADH oxidation and proton translocation across the inner mitochondrial membrane .

Mechanistic Contributions

  • Electron Transfer: Participates in the peripheral arm of Complex I, facilitating electron flow from FMN to ubiquinone .

  • Proton Pumping: Contributes to the transmembrane domain, enabling proton extrusion .

Comparison with Human ND6

FeatureB. lanceolatum ND6Human ND6 (MT-ND6)
Length167 aa172 aa
Gene LocationNuclear genome (recombinant)Mitochondrial L-strand (14,149–14,673 bp)
Clinical RelevanceResearch toolAssociated with LHON, Leigh syndrome, dystonia
Protein FeaturesHydrophobic transmembrane domainsIncludes redox-active Fe-S clusters

Applications in Research

SDS-PAGE and ELISA

  • SDS-PAGE: Used to verify protein purity and molecular weight .

  • ELISA Kits: Available for quantification (e.g., CSB-EP015082BVZ1 at $1,511.00 for 50 µg) .

Functional Studies

  • Complex I Assembly: Investigates interactions with nuclear-encoded subunits (e.g., NDUFS3, YME1L1) .

  • Evolutionary Insights: Compares B. lanceolatum ND6 with human homologs to study mitochondrial evolution .

Handling and Stability

  • Avoid Freeze-Thaw Cycles: Working aliquots stored at 4°C for ≤1 week .

  • Buffer Compatibility: Tris/PBS-based buffer with trehalose stabilizes protein structure .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer requirements.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
ND6; NAD6; NADH6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Branchiostoma lanceolatum (Common lancelet) (Amphioxus lanceolatum)
Target Names
ND6
Target Protein Sequence
MQMMLMFLLLLAAIMVIRATSPYYGALATAWLALLAALLLLDADIIFPAIILMLIYLGGM LVVFIYSTAYAADLMPLPINLTMSALMASFGVMLITMISSPSIETLCETKPWLVYDMQPS YMLFDIYQRGSSMFIVAVMILTALLFSILEVVSHRQTTMKWFIHSTY
Uniprot No.

Target Background

Function

Recombinant Branchiostoma lanceolatum NADH-ubiquinone oxidoreductase chain 6 (ND6): A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.