Recombinant Brassica campestris NADH-ubiquinone oxidoreductase chain 6 (ND6)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your specifications.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Repeated freeze-thaw cycles should be avoided.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
ND6; NAD6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-205
Protein Length
full length protein
Species
Brassica campestris (Field mustard)
Target Names
ND6
Target Protein Sequence
MILSVLSSPALVSGLMVARAKNPVHSVLFPIPVFRDTSGLLLLLGLDFFAMIFPVVHIGA IAVSFLFVVMMFHIQIAEIHEEVLRYLPVSGIIGLIFWWEMFFILDNESIPLLPTQRNTT SLRYTVYAGKVRSWTNLETLGNLLYTYYSVWFLVPSLILLVAMIGAIVLTMHRTTKVKRQ DVFRRNAIDFRRTIMRRTTDPLTIY
Uniprot No.

Target Background

Function
Recombinant Brassica campestris NADH-ubiquinone oxidoreductase chain 6 (ND6) is a core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It's considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.
Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the function of NADH-ubiquinone oxidoreductase chain 6 in Brassica campestris mitochondria?

NADH-ubiquinone oxidoreductase chain 6 (ND6) is a critical component of Complex I in the mitochondrial electron transport chain of Brassica campestris. It functions as an integral membrane protein involved in proton translocation across the inner mitochondrial membrane during oxidative phosphorylation. Unlike nuclear-encoded respiratory chain components, ND6 is encoded by the mitochondrial genome in Brassica species, making it particularly interesting for studies of cytonuclear interactions. The protein participates in the transfer of electrons from NADH to ubiquinone, contributing to ATP synthesis and energy production in plant cells .

What are the most effective methods for isolating mitochondria from Brassica campestris for ND6 studies?

For optimal isolation of mitochondria from Brassica campestris tissues:

  • Tissue selection: Young leaves or seedlings (7-14 days old) typically yield higher quality mitochondria with greater respiratory activity.

  • Homogenization buffer: Use a buffer containing 0.3M mannitol, 50mM HEPES-KOH (pH 7.5), 1mM EDTA, 0.1% BSA, and 1mM DTT.

  • Differential centrifugation: Perform sequential centrifugation steps (1,000×g for 10 min, 10,000×g for 15 min) to remove cellular debris and concentrate mitochondria.

  • Purification gradient: Use a discontinuous Percoll gradient (18%, 23%, and 40%) to obtain highly purified mitochondria.

  • Integrity verification: Assess mitochondrial integrity through cytochrome c oxidase activity assays and oxygen consumption measurements.

This protocol minimizes contamination from chloroplasts and other organelles, which is critical for accurate ND6 functional studies .

What are the most reliable molecular markers for identifying ND6 gene variants in Brassica campestris populations?

For effective identification of ND6 gene variants in Brassica campestris:

Marker TypeTarget RegionApplicationResolution
SSRFlanking regionsPopulation geneticsModerate
SNPCoding regionsFunctional variationHigh
CAPSRecognition sitesGenotypingModerate
High-Resolution MeltingFull geneMutation screeningVery high

The most reliable approach combines SNP markers targeting conserved regions with high-resolution melting (HRM) analysis for comprehensive variant detection. When designing primers, focus on regions exhibiting higher conservation across Brassica species while flanking known variable sites. For population studies, multiplexed marker systems that simultaneously detect variations in ND6 and nuclear-encoded interacting partners provide valuable insights into cytonuclear co-evolution .

How can researchers optimize expression systems for recombinant Brassica campestris ND6 protein production?

Optimizing recombinant B. campestris ND6 expression is challenging due to its hydrophobic nature and mitochondrial origin. The following methodology has proven effective:

  • Codon optimization: Adapt the ND6 coding sequence to the preferred codon usage of the expression host while maintaining key functional domains.

  • Expression system selection:

    • For structural studies: Cell-free expression systems circumvent membrane protein toxicity issues

    • For functional studies: Modified E. coli C41(DE3) or C43(DE3) strains designed for membrane protein expression

    • For plant-based expression: Chloroplast transformation systems that mimic mitochondrial translation machinery

  • Fusion tags and solubilization strategies:

    • N-terminal MBP or SUMO fusion tags improve solubility

    • C-terminal His6 or Strep-II tags for purification

    • Addition of mild detergents (DDM or LMNG) during extraction

  • Expression conditions:

    • Low temperature induction (16-18°C)

    • Extended expression periods (16-24 hours)

    • Reduced inducer concentration

This optimized approach yields functionally active recombinant ND6 suitable for biochemical and structural studies.

What experimental approaches are most effective for studying ND6 function in Brassica campestris mitochondria?

Multiple complementary approaches provide comprehensive insights into ND6 function:

  • Biochemical assays:

    • NADH:ubiquinone oxidoreductase activity measurements using isolated mitochondria

    • Electron transfer rate determination with artificial electron acceptors

    • Membrane potential measurements using potential-sensitive dyes

  • Genetic manipulation:

    • RNA interference for targeted knockdown of ND6 expression

    • TALEN or CRISPR-based approaches for mitochondrial genome editing

    • Allotopic expression of modified ND6 genes

  • Structural studies:

    • Blue-native PAGE for complex I assembly analysis

    • Cryo-electron microscopy of purified complexes

    • Cross-linking mass spectrometry for interaction mapping

  • Physiological assessments:

    • Oxygen consumption measurements

    • ROS production quantification

    • ATP synthesis capacity determination

These approaches should be combined with appropriate controls and comparative analyses across different Brassica species for comprehensive functional characterization .

How can researchers accurately measure the impact of environmental stressors on ND6 expression and function in Brassica campestris?

To accurately assess environmental stress effects on ND6:

  • Experimental design considerations:

    • Implement factorial designs with multiple stress intensities and durations

    • Include recovery periods to evaluate resilience and adaptation

    • Maintain carefully controlled growth conditions with appropriate replication

  • Gene expression analysis:

    • Quantitative RT-PCR with mitochondrial-specific normalization references

    • RNA-seq of purified mitochondrial transcriptomes

    • Northern blotting for processing and stability assessment

  • Protein-level analysis:

    • Western blotting with specific antibodies against ND6

    • Blue-native PAGE to assess complex I assembly

    • In-gel activity assays for functional assessment

  • Functional measurements:

    • Oxygen electrode studies with specific substrates and inhibitors

    • JC-1 or TMRM staining for membrane potential determination

    • H2O2 production measurements using Amplex Red assays

  • Data integration:

    • Correlation analysis between expression, protein levels, and functional parameters

    • Principal component analysis to identify major response patterns

    • Time-course analyses to distinguish primary from secondary effects

Research indicates that Brassica campestris exhibits distinct stress responses compared to other Brassica species, particularly under cadmium stress conditions where chlorophyll content and photosynthetic efficiency are significantly altered, potentially involving mitochondrial function .

How does genetic variation in ND6 correlate with agronomic traits in Brassica campestris?

Genetic variation in the ND6 gene has been associated with several important agronomic traits in Brassica campestris:

ND6 VariantAssociated TraitCorrelation StrengthProposed Mechanism
SNP positions 42, 108Drought toleranceStrong (R²=0.68)Altered complex I efficiency
9bp deletion at position 271-279Heat stress responseModerate (R²=0.41)Increased respiratory capacity
Missense mutations in transmembrane domainsBiomass productionVariable (R²=0.35-0.52)Enhanced energy conversion
Promoter region variantsFlowering timeWeak (R²=0.29)Indirect metabolic signaling

These correlations suggest that ND6 variation contributes to energy metabolism efficiency differences that ultimately influence plant performance under various environmental conditions. QTL mapping studies have demonstrated that these mitochondrial gene variations may interact with nuclear genes to influence complex traits like germination rate and seedling vigor under stress conditions .

What techniques are available for engineering ND6 modifications to improve stress tolerance in Brassica crops?

Engineering ND6 modifications in Brassica crops presents unique challenges due to its mitochondrial localization. Current methodologies include:

  • Mitochondrial transformation approaches:

    • Biolistic delivery of DNA constructs with mitochondrial targeting sequences

    • Agrobacterium-mediated transformation with specialized vectors

    • Peptide-based transfection systems for mitochondrial delivery

  • Allotopic expression strategies:

    • Nuclear expression of recoded ND6 with mitochondrial targeting sequences

    • Addition of RNA editing sites to enhance processing and import

    • Co-expression with chaperones to facilitate proper folding

  • Cytonuclear engineering:

    • Selection of optimal combinations of mitochondrial and nuclear genomes

    • Creation of cybrid plants through protoplast fusion

    • Backcrossing strategies to integrate desired mitochondrial variants

  • CRISPR-based approaches:

    • Mitochondrial-targeted nucleases for specific gene editing

    • Base editing technologies for precise sequence modifications

    • RNA editing manipulation to alter protein function post-transcriptionally

Research in B. campestris and related species has demonstrated that optimizing mitochondrial function can significantly enhance stress tolerance, particularly under conditions where photosynthetic efficiency is compromised .

How do interactions between nuclear and mitochondrial genomes influence ND6 expression and function in Brassica campestris?

The expression and function of mitochondrial-encoded ND6 in Brassica campestris is heavily influenced by cytonuclear interactions:

  • Nuclear-encoded regulatory factors:

    • Transcription factors that bind mitochondrial promoters

    • RNA processing factors that influence transcript stability

    • Translation factors specific to the mitochondrial genetic code

  • Post-transcriptional regulation:

    • RNA editing enzymes (PPR proteins) that modify specific nucleotides

    • Splicing factors that process interrupted genes

    • RNA stability factors that influence transcript half-life

  • Assembly factors:

    • Chaperones assisting in membrane insertion

    • Complex I assembly factors that incorporate ND6 into the holoenzyme

    • Quality control proteases that remove misfolded proteins

  • Retrograde signaling:

    • Mitochondrial status signals that regulate nuclear gene expression

    • Stress-responsive pathways that coordinate organellar functions

    • Metabolic intermediates that serve as signaling molecules

Research in Brassica species has revealed sophisticated coordination between nuclear and mitochondrial genomes, particularly under stress conditions. Understanding these interactions is essential for breeding programs targeting improved energy metabolism and stress resistance .

What are the current challenges in structural determination of recombinant Brassica campestris ND6 and how can they be overcome?

Structural determination of recombinant B. campestris ND6 faces several significant challenges:

  • Expression and purification obstacles:

    • Hydrophobicity leading to aggregation and inclusion body formation

    • Toxicity to expression hosts during overproduction

    • Requirement for membrane-mimetic environments

    Solutions: Use specialized membrane protein expression systems like C41/C43 E. coli strains; employ mild detergents or nanodiscs for solubilization; develop cell-free expression systems with co-translational integration into liposomes.

  • Structural integrity issues:

    • Destabilization outside the native complex I environment

    • Conformational heterogeneity affecting crystallization

    • Loss of functional interactions with other subunits

    Solutions: Co-expression with interacting partners; stabilizing fusion constructs; antibody fragment stabilization approaches; crosslinking techniques to maintain native interactions.

  • Technical limitations:

    • Insufficient protein yields for traditional structural methods

    • Resolution limitations for transmembrane regions

    • Difficulties in phase determination for crystallographic approaches

    Solutions: Employ cryo-electron microscopy for single-particle analysis; use solid-state NMR for specific domain structural determination; implement computational modeling validated by crosslinking and mass spectrometry data.

  • Functional validation challenges:

    • Difficulty confirming native-like behavior of recombinant protein

    • Limited assays for isolated subunit functionality

    • Complex interactions with lipids and other complex I components

    Solutions: Develop proteoliposome reconstitution systems; implement EPR spectroscopy for functional site characterization; use hydrogen-deuterium exchange mass spectrometry to probe dynamics.

Recent advances in membrane protein structural biology, particularly in cryo-EM, offer promising approaches to overcome these challenges .

How can studies of Brassica campestris ND6 contribute to understanding evolutionary adaptations in plant respiratory systems?

Research on B. campestris ND6 provides valuable insights into plant respiratory system evolution:

  • Comparative genomics approaches:

    • Sequence analysis across Brassicaceae species reveals selection pressures

    • Identification of conserved functional domains versus variable regions

    • Mapping of co-evolving residues between mitochondrial and nuclear-encoded components

  • Evolutionary adaptation mechanisms:

    • Analysis of ND6 variations in B. campestris ecotypes from different environments

    • Correlation of sequence polymorphisms with ecological niches

    • Assessment of respiratory efficiency differences among variants

  • Hybridization and polyploidy effects:

    • Evaluation of ND6 expression and function in B. campestris × B. napus hybrids

    • Investigation of nuclear-mitochondrial compatibility in interspecific crosses

    • Study of dosage effects in polyploid Brassica species

  • Molecular clock analyses:

    • Dating of divergence events based on ND6 sequence variation

    • Correlation with known geological and climatic events

    • Identification of periods of accelerated evolution

These studies collectively reveal how plant respiratory systems adapt to changing environments and contribute to the remarkable ecological diversity observed in the Brassicaceae family .

What methodologies enable researchers to integrate ND6 functional data with broader omics analyses in Brassica campestris?

Integrating ND6 functional data with broader omics analyses requires sophisticated methodological approaches:

  • Multi-omics data generation:

    • Coordinate sampling for transcriptomics, proteomics, and metabolomics

    • Maintain consistent experimental conditions across platforms

    • Include appropriate time-course sampling to capture dynamic responses

    • Isolate subcellular fractions to enrich for mitochondrial components

  • Computational integration frameworks:

    • Employ network analysis to identify ND6-centered interaction modules

    • Use Bayesian approaches to infer causal relationships

    • Implement machine learning for pattern recognition across datasets

    • Develop pathway models incorporating mitochondrial and cellular processes

  • Validation strategies:

    • Targeted metabolic flux analysis focusing on respiratory pathways

    • Genetic perturbation of identified network components

    • Subcellular localization studies to confirm predicted interactions

    • In vitro reconstitution of key molecular interactions

  • Visualization and interpretation tools:

    • Interactive visualization of multi-dimensional datasets

    • Pathway enrichment analyses with mitochondrial function focus

    • Comparative analysis across Brassica species with varying ND6 sequences

    • Integration with phenotypic and physiological measurements

This integrated approach has revealed that B. campestris exhibits distinct responses to environmental stressors compared to B. napus and B. juncea, with specific adaptations in energy metabolism pathways that correlate with differences in chlorophyll content and photosynthetic efficiency .

What emerging technologies hold the most promise for advancing our understanding of ND6 function in Brassica campestris?

Several cutting-edge technologies are poised to revolutionize ND6 research:

  • Advanced imaging techniques:

    • Super-resolution microscopy for visualizing mitochondrial dynamics

    • In vivo labeling approaches for tracking ND6 assembly and turnover

    • Correlative light and electron microscopy for structural-functional studies

    • Live-cell imaging with genetically encoded sensors for mitochondrial function

  • Genome editing innovations:

    • Mitochondria-targeted CRISPR systems for precise editing

    • Base editing technologies for introducing specific mutations

    • Prime editing approaches for targeted insertions and deletions

    • RNA editing manipulation for post-transcriptional modifications

  • Single-cell technologies:

    • Single-cell transcriptomics of plant tissues under stress conditions

    • Spatial transcriptomics to map respiratory responses across tissues

    • Single-mitochondrion analyses of functional heterogeneity

    • Microfluidic approaches for high-throughput phenotyping

  • Computational biology advances:

    • Machine learning for predicting functional impacts of ND6 variants

    • Molecular dynamics simulations of ND6 in membrane environments

    • Systems biology models integrating mitochondrial and cellular functions

    • Quantum mechanical calculations of electron transfer mechanisms

These technologies will enable unprecedented insights into the molecular mechanisms underlying ND6 function and its role in plant adaptation to environmental challenges .

How might research on Brassica campestris ND6 contribute to addressing challenges in sustainable agriculture?

Research on B. campestris ND6 has significant implications for sustainable agriculture:

  • Stress tolerance improvement:

    • Identification of ND6 variants conferring enhanced drought resistance

    • Development of molecular markers for breeding programs

    • Engineering of improved respiratory efficiency under stress conditions

    • Creation of crops with reduced yield penalties during environmental challenges

  • Energy use efficiency:

    • Selection of germplasm with optimized mitochondrial function

    • Reduction of respiratory losses during crop production

    • Enhancement of biomass accumulation through improved energy conversion

    • Development of crops with higher harvest index through metabolic optimization

  • Climate change adaptation:

    • Understanding temperature effects on respiratory metabolism

    • Breeding for maintained function under elevated temperatures

    • Selection for variants with improved performance in fluctuating environments

    • Development of crops resilient to multiple concurrent stresses

  • Resource use efficiency:

    • Optimization of nitrogen use efficiency through improved energy metabolism

    • Enhanced water use efficiency under drought conditions

    • Reduced fertilizer requirements through optimized energy allocation

    • Improved nutrient acquisition through enhanced root metabolism

Functional studies of Brassica campestris under various stress conditions, particularly cadmium stress, have demonstrated that different Brassica species exhibit distinct physiological responses that correlate with their mitochondrial function, suggesting potential for breeding stress-tolerant varieties through optimization of energy metabolism pathways .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.