Recombinant Brassica napus 1-acyl-sn-glycerol-3-phosphate acyltransferase 1, chloroplastic (LPAT1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
BAT2; ACT2; LPAT1; BnaA03g50320D; GSBRNA2T00067440001; 1-acyl-sn-glycerol-3-phosphate acyltransferase BAT2, chloroplastic; Lysophosphatidyl acyltransferase 1; Protein BRASSICA ACYLTRANSFERASE 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
88-344
Protein Length
Full Length of Mature Protein
Species
Brassica napus (Rape)
Target Names
LPAT1
Target Protein Sequence
SDLSGAATPESTYPEPEIKLSSRLRGICFCLVAGISAIVLIVLMIIGHPFVLLFDRYRRK FHHFIAKLWASISIYPFYKTDIQGLENLPSSDTPCVYVSNHQSFLDIYTLLSLGQSYKFI SKTGIFVIPVIGWAMSMMGVVPLKRMDPRSQVDCLKRCMELVKKGASVFFFPEGTRSKDG RLGPFKKGAFTIAAKTGVPVVPITLMGTGKIMPTGSEGILNHGDVRVIIHKPIYGSKADV LCEEARNKIAESMNLLS
Uniprot No.

Target Background

Function

This plastidial enzyme, part of the prokaryotic glycerol-3-phosphate pathway, converts lysophosphatidic acid (LPA) to phosphatidic acid by acylating the sn-2 position. It utilizes palmitoyl-ACP (16:0-ACP) to produce phosphatidic acid with a saturated sn-2 group, a characteristic of prokaryotic pathway lipids. In vitro studies demonstrate its ability to utilize 16:0-CoA as an acyl donor.

Database Links

KEGG: bna:106441094

UniGene: Bna.2206

Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Plastid, chloroplast membrane; Multi-pass membrane protein.
Tissue Specificity
Widely expressed.

Q&A

What is the biochemical function of Brassica napus LPAT1 in plant lipid metabolism?

Brassica napus 1-acyl-sn-glycerol-3-phosphate acyltransferase 1 (LPAT1) is a chloroplastic enzyme that catalyzes the second step in glycerolipid assembly through the acylation of lysophosphatidic acid (LPA) to produce phosphatidic acid (PA). This reaction is a key intermediate step in the prokaryotic pathway of lipid synthesis that occurs within chloroplasts.

The enzyme functions by transferring an acyl group from acyl-ACP (acyl carrier protein) to the sn-2 position of LPA. In the lipid biosynthesis pathway, LPAT1 works downstream of glycerol-3-phosphate acyltransferase (GPAT/ATS1), which catalyzes the first acylation step to produce LPA from glycerol-3-phosphate .

How is BnLPAT1 structurally related to other acyltransferases in the Kennedy pathway?

BnLPAT1 belongs to the family of membrane-bound acyltransferases that participate in the Kennedy pathway of lipid synthesis. Structurally, it shares amino acid sequence similarity with other plastidic LPATs, particularly its Arabidopsis thaliana ortholog (AtLPAT1, also known as ATS2).

The protein contains conserved acyltransferase domains and transmembrane regions that anchor it to the chloroplast membrane. The enzyme possesses catalytic residues required for its acyltransferase activity, including the ability to recognize and bind both LPA and acyl-ACP substrates. Analysis of its amino acid sequence reveals a chloroplast transit peptide at the N-terminus that directs the protein to its correct subcellular location .

What is known about the substrate specificity of BnLPAT1?

The substrate specificity of BnLPAT1 has not been extensively characterized in the available search results, but insights can be drawn from related enzymes. As a chloroplastic LPAT, it likely shows preference for acyl-ACPs rather than acyl-CoAs as acyl donors, consistent with its role in the prokaryotic pathway.

Based on studies of homologous enzymes, BnLPAT1 would be expected to show preference for incorporating 16:0 (palmitic) and 18:1 (oleic) acyl groups at the sn-2 position of LPA. This contrasts with microsomal LPATs involved in the eukaryotic pathway, which typically incorporate unsaturated fatty acids at this position .

What expression systems are most effective for producing recombinant BnLPAT1?

Based on available information, Escherichia coli is the most commonly used expression system for producing recombinant BnLPAT1. The protein is typically expressed as a fusion with an N-terminal His-tag to facilitate purification. The expression construct generally includes the mature protein sequence (amino acids 88-344) without the chloroplast transit peptide .

While E. coli is the predominant system, other expression hosts including yeast, baculovirus, and mammalian cell systems have also been employed for recombinant production of plant acyltransferases. Each system offers different advantages in terms of post-translational modifications, protein folding, and expression yields .

What are the key challenges in purifying functional BnLPAT1, and how can they be overcome?

Purifying BnLPAT1 presents several challenges common to membrane-bound enzymes:

  • Solubilization: As an integral membrane protein, BnLPAT1 requires effective solubilization from membranes using detergents. Based on studies with related enzymes such as BnaDGAT1, n-dodecyl-β-D-maltopyranoside (DDM) has proven effective for solubilizing membrane-bound acyltransferases while maintaining their activity .

  • Maintaining stability and activity: The protein may lose activity during purification due to detergent effects or removal from its native lipid environment. This can be mitigated by:

    • Optimizing buffer conditions (pH, salt concentration)

    • Including glycerol in storage buffers (typically 50%)

    • Adding stabilizing agents like trehalose

  • Purification strategy: A typical purification protocol would include:

    • Cobalt or nickel affinity chromatography using the His-tag

    • Size-exclusion chromatography to separate protein from detergent micelles and to isolate properly folded protein

The purified protein should be stored with 50% glycerol at -20°C or -80°C to maintain stability, avoiding repeated freeze-thaw cycles .

How can researchers verify the proper folding and activity of purified recombinant BnLPAT1?

Verification of proper folding and activity of purified BnLPAT1 can be accomplished through multiple complementary approaches:

  • Enzymatic activity assay: The purified enzyme should be tested for its ability to catalyze the acylation of LPA to form PA. This typically involves:

    • Incubating the enzyme with LPA and acyl-ACP substrates

    • Analyzing reaction products by thin-layer chromatography (TLC) or liquid chromatography-mass spectrometry (LC-MS)

    • Calculating specific activity (nmol product/min/mg protein)

  • Biophysical characterization:

    • Circular dichroism (CD) spectroscopy to assess secondary structure

    • Size-exclusion chromatography to evaluate oligomeric state

    • Thermal shift assays to determine protein stability

  • Functional complementation: Testing the ability of the recombinant enzyme to rescue LPAT-deficient mutants in heterologous systems such as yeast .

What methods are effective for determining the subcellular localization of BnLPAT1?

The subcellular localization of BnLPAT1 can be experimentally determined using several approaches:

  • Fluorescent protein fusion and confocal microscopy:

    • Construct a C-terminal fusion of BnLPAT1 with GFP

    • Transiently express the fusion protein in plant tissues (such as tobacco leaf epidermal cells) via Agrobacterium infiltration

    • Visualize using confocal microscopy, where co-localization with chloroplast autofluorescence confirms chloroplastic localization

  • Subcellular fractionation and immunoblotting:

    • Isolate different cellular fractions (chloroplasts, ER, mitochondria)

    • Perform Western blot analysis using antibodies specific to BnLPAT1

    • Compare distribution across fractions with known organelle markers

  • Immunogold electron microscopy:

    • Use antibodies against BnLPAT1 with gold-conjugated secondary antibodies

    • Visualize the precise sub-organellar localization within chloroplasts at high resolution

The chloroplastic localization of BnLPAT1 is consistent with its role in the prokaryotic pathway of lipid synthesis .

How can gene expression patterns of BnLPAT1 be analyzed across different tissues and developmental stages?

Analysis of BnLPAT1 expression patterns can be accomplished using the following approaches:

  • Quantitative real-time PCR (qRT-PCR):

    • Design primers specific to BnLPAT1, avoiding cross-amplification with other LPAT homologs

    • Extract RNA from different tissues (leaves, developing seeds, flowers, roots)

    • Perform qRT-PCR with appropriate reference genes for normalization

    • Compare expression levels across tissues and developmental stages

  • RNA-Seq analysis:

    • Generate transcriptome data from various tissues and developmental stages

    • Map reads to the BnLPAT1 sequence

    • Calculate FPKM/TPM values to quantify expression levels

    • Perform differential expression analysis between tissues and stages

  • Promoter-reporter fusion studies:

    • Clone the BnLPAT1 promoter region upstream of a reporter gene (GUS or GFP)

    • Generate transgenic plants and analyze reporter activity in different tissues

    • Document spatial and temporal expression patterns through histochemical staining or fluorescence imaging

Studies of related acyltransferases have shown tissue-specific expression patterns, with some isoforms being predominantly expressed in developing seeds while others show broader expression across vegetative tissues .

What techniques can be used to investigate the regulation of BnLPAT1 activity?

The regulation of BnLPAT1 activity can be investigated using several complementary approaches:

  • Enzyme kinetics studies:

    • Determine substrate affinities (Km values) for LPA and various acyl donors

    • Investigate potential allosteric regulators by testing activity in the presence of metabolites like CoA or phosphatidic acid

    • Analyze the effects of different reaction conditions (pH, temperature, ion concentrations) on enzyme activity

  • Post-translational modification analysis:

    • Examine potential phosphorylation sites using mass spectrometry

    • Test the effects of specific kinases or phosphatases on enzyme activity

    • Use site-directed mutagenesis to modify potential regulatory sites

  • Protein-protein interaction studies:

    • Perform yeast two-hybrid or co-immunoprecipitation experiments to identify interacting proteins

    • Investigate how these interactions affect enzyme activity

    • Map interaction domains through truncation and mutation analyses

  • Transcriptional regulation:

    • Analyze the promoter region for regulatory elements

    • Perform chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the BnLPAT1 promoter

    • Test the effects of environmental signals (nutrient status, temperature, light) on expression levels

What strategies have been successful for modifying BnLPAT1 expression in Brassica napus?

Several strategies have been employed to modify BnLPAT1 expression in Brassica napus:

  • RNA interference (RNAi):

    • Design constructs containing inverted repeats of BnLPAT1 sequences

    • Express under tissue-specific promoters like the napin promoter for seed-specific silencing

    • Transform plants using Agrobacterium-mediated methods

    • Select transformants using appropriate markers and confirm knockdown by qRT-PCR

  • Overexpression:

    • Clone the complete coding sequence of BnLPAT1 under strong constitutive promoters (e.g., CaMV 35S) or tissue-specific promoters

    • Transform plants and select lines with varied expression levels

    • Confirm overexpression through qRT-PCR and Western blotting

  • CRISPR/Cas9 genome editing:

    • Design guide RNAs targeting specific regions of the BnLPAT1 gene

    • Transform plants with CRISPR/Cas9 constructs

    • Screen for mutations and characterize edited plants

Each approach has advantages depending on research objectives, with RNAi allowing for partial knockdown and potential circumvention of lethality issues, while CRISPR/Cas9 can create complete knockouts for more definitive functional analysis.

How does alteration of BnLPAT1 expression affect lipid composition and plant development?

Alteration of BnLPAT1 expression has significant effects on both lipid composition and plant development:

  • Effects on lipid composition:

    • Modification of membrane glycerolipid profiles, particularly phosphatidylglycerol (PG) and monogalactosyldiacylglycerol (MGDG)

    • Changes in fatty acid distribution between prokaryotic and eukaryotic pathways

    • Altered ratios of lipid classes derived from the prokaryotic pathway

  • Effects on plant development:

    • Impacts on reproductive organ development, including pollen grains and embryo sacs

    • Abnormal embryo development affecting oil body morphology

    • Changes in seed oil content and fatty acid composition

    • Potential effects on vegetative growth, particularly under stress conditions

  • Molecular responses:

    • Compensatory changes in expression of other acyltransferases

    • Altered expression of genes involved in lipid metabolism pathways

    • Redistribution of carbon flow between membrane and storage lipid synthesis

The specific effects depend on whether BnLPAT1 is overexpressed or downregulated, and the tissue specificity of the modification.

What methods are appropriate for analyzing phenotypic changes in BnLPAT1-modified plants?

Comprehensive analysis of phenotypic changes in BnLPAT1-modified plants requires multiple analytical approaches:

  • Lipid profiling:

    • Extraction of total lipids from different tissues

    • Separation of lipid classes by thin-layer chromatography or HPLC

    • Quantification of lipid species by GC-MS or LC-MS/MS

    • Analysis of fatty acid composition by GC-FID after transmethylation

  • Developmental analysis:

    • Microscopic examination of reproductive organs (pollen, embryo sacs)

    • Histological analysis of developing seeds

    • Measurement of seed set and yield components

    • Assessment of seedling establishment and growth parameters

  • Cellular and subcellular analyses:

    • Electron microscopy to examine oil body morphology

    • Confocal microscopy with fluorescent lipid dyes

    • Immunolocalization of proteins involved in lipid metabolism

  • Transcriptomic and proteomic analyses:

    • RNA-Seq to assess global transcriptional changes

    • Proteomics to identify changes in protein abundance

    • Analysis of specific lipid metabolism enzymes by qRT-PCR and Western blotting

  • Physiological measurements:

    • Photosynthetic parameters (particularly for chloroplastic lipid modifications)

    • Stress response assays (cold tolerance, drought response)

    • Growth measurements under different environmental conditions

How can BnLPAT1 be utilized for engineering improved oil content or composition in oilseed crops?

BnLPAT1 offers several strategies for engineering improved oil traits in oilseed crops:

  • Manipulation of carbon partitioning:

    • Strategic modification of BnLPAT1 expression can alter the balance between prokaryotic and eukaryotic pathways

    • This redirection of carbon flux may increase availability of precursors for triacylglycerol (TAG) synthesis

    • Combined manipulation with other acyltransferases like DGAT1 may have synergistic effects

  • Alteration of fatty acid composition:

    • Engineering BnLPAT1 substrate specificity through directed evolution or rational design

    • Creating chimeric enzymes with domains from LPATs with different specificities

    • Expression of engineered BnLPAT1 variants to incorporate specific fatty acids into glycerolipids

  • Coordination with other metabolic engineering strategies:

    • Combined expression of BnLPAT1 with other Kennedy pathway enzymes

    • Integration with fatty acid synthesis enhancement

    • Suppression of competing pathways to maximize flux toward TAG accumulation

  • Tissue-specific approaches:

    • Seed-specific overexpression using promoters like napin

    • Engineering of BnLPAT1 regulatory elements to enhance expression during oil accumulation

    • Fine-tuning expression to avoid developmental abnormalities

What experimental approaches can reveal the interactions between BnLPAT1 and other enzymes in the glycerolipid assembly pathway?

Understanding interactions within the glycerolipid assembly pathway requires integrated experimental approaches:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation followed by mass spectrometry to identify interacting partners

    • Split-ubiquitin yeast two-hybrid assays optimized for membrane proteins

    • Bimolecular fluorescence complementation to visualize interactions in planta

    • Proximity labeling approaches like BioID to capture transient interactions

  • Metabolic flux analysis:

    • Pulse-chase experiments with labeled precursors

    • Quantification of intermediates and products by mass spectrometry

    • Mathematical modeling of lipid metabolism networks

    • Comparison between wild-type and BnLPAT1-modified plants

  • Multi-enzyme activity assays:

    • Reconstitution of partial or complete pathways using purified recombinant enzymes

    • Analysis of substrate channeling and metabolic compartmentalization

    • Examination of rate-limiting steps and regulatory nodes

  • Systems biology approaches:

    • Integration of transcriptomics, proteomics, and lipidomics data

    • Network analysis to identify coordinated enzyme activities

    • Incorporation of protein interaction networks with metabolic networks

EnzymePathway LocationSubstrate PreferenceCellular LocalizationRole in Network
BnLPAT1ProkaryoticLPA + acyl-ACPChloroplastKey node in prokaryotic pathway
BnGPATProkaryotic/EukaryoticG3P + acyl-CoA/acyl-ACPChloroplast/ERUpstream of LPAT1
BnLPCATEukaryoticLPC + acyl-CoAERPC remodeling
BnDGAT1EukaryoticDAG + acyl-CoAERFinal step in TAG synthesis

How do environmental factors influence BnLPAT1 expression and activity, and what are the implications for crop improvement?

Environmental factors have significant impacts on BnLPAT1 expression and activity with important implications for crop improvement:

  • Temperature effects:

    • Low temperature can induce changes in BnLPAT1 expression to maintain membrane fluidity

    • Overexpression of BnLPAT1 or related enzymes has been shown to enhance low-temperature tolerance through increased production of polyunsaturated fatty acids in membrane lipids

    • Engineering BnLPAT1 regulation could improve cold tolerance in Brassica crops

  • Nutrient availability:

    • Phosphate starvation affects lipid metabolism gene expression, potentially including BnLPAT1

    • Analysis of transcription factors like BnPHR1 shows they regulate multiple phosphate starvation-responsive genes and may influence lipid metabolism under phosphate limitation

    • Optimizing BnLPAT1 expression under variable nutrient conditions could improve crop resilience

  • Developmental programming:

    • BnLPAT1 expression varies during seed development, affecting oil accumulation patterns

    • Understanding the regulatory mechanisms controlling temporal expression could allow for extended oil accumulation periods

    • Manipulating these pathways could enhance total oil yield

  • Interaction with stress signaling:

    • Lipid metabolism enzymes respond to various stresses (drought, salinity, pathogen attack)

    • Monitoring BnLPAT1 expression under stress conditions provides insights into its role in stress adaptation

    • Targeted modification of BnLPAT1 regulation could improve stress tolerance while maintaining oil yield

Understanding these environmental interactions provides opportunities for developing climate-resilient high-oil Brassica napus varieties through strategic engineering of BnLPAT1 and related lipid metabolism genes .

What are the current limitations in BnLPAT1 functional characterization, and how might they be addressed?

Current limitations in BnLPAT1 research include:

  • Structural characterization challenges:

    • Difficulty in obtaining crystal structures of membrane-bound acyltransferases

    • Limited understanding of substrate binding sites and catalytic mechanism

    • Future approach: Apply cryo-electron microscopy, computational modeling, and directed evolution approaches to elucidate structure-function relationships

  • Functional redundancy:

    • Multiple LPAT isoforms in Brassica napus with potentially overlapping functions

    • Difficulty isolating specific effects of BnLPAT1 manipulation

    • Future approach: Generate combinatorial mutants and employ CRISPR/Cas9 to target multiple LPAT genes simultaneously

  • Complex metabolic integration:

    • Interconnected nature of lipid metabolism pathways complicates interpretation of phenotypes

    • Compensatory changes in other pathways may mask direct effects

    • Future approach: Apply stable isotope labeling combined with comprehensive lipidomics to track metabolic fluxes more precisely

  • Translation to field conditions:

    • Laboratory findings may not predict performance under variable field conditions

    • Future approach: Conduct field trials under multiple environments to assess stability of engineered traits and identify genotype-by-environment interactions

How might emerging technologies advance our understanding of BnLPAT1 function and regulation?

Emerging technologies offer exciting opportunities to advance BnLPAT1 research:

  • Single-cell omics:

    • Single-cell transcriptomics to reveal cell-type-specific expression patterns

    • Spatial transcriptomics to map BnLPAT1 expression across tissues with high resolution

    • Single-cell proteomics to identify cell-specific protein complexes involving BnLPAT1

  • Advanced imaging techniques:

    • Super-resolution microscopy to visualize subcellular localization with precision

    • Label-free imaging methods like Raman microscopy to track lipid distribution in situ

    • Correlative light and electron microscopy to connect protein localization with ultrastructure

  • Genome editing advances:

    • Prime editing for precise modification of BnLPAT1 regulatory elements or coding sequence

    • Base editing to introduce specific amino acid changes

    • Tissue-specific CRISPR systems to modify BnLPAT1 in targeted cell types

  • Artificial intelligence applications:

    • Machine learning to predict optimal BnLPAT1 expression patterns for specific environments

    • Integrative modeling of lipid metabolism networks

    • Automated phenotyping to detect subtle changes in plant development and metabolism

These emerging approaches will enable more precise manipulation of BnLPAT1 and deeper understanding of its role in coordinating lipid metabolism .

What are the most promising translational research directions for BnLPAT1 in improving Brassica napus as an oil crop?

The most promising translational research directions include:

  • Precision engineering for oil enhancement:

    • Fine-tuning of BnLPAT1 expression specifically during seed filling

    • Engineering substrate specificity to incorporate beneficial fatty acids

    • Balancing oil quantity enhancement with seed vigor and germination

  • Climate resilience improvement:

    • Developing variants with optimized expression under temperature extremes

    • Engineering regulatory elements to respond adaptively to environmental conditions

    • Creating lines with enhanced membrane lipid composition for stress tolerance

  • Multi-gene pathway optimization:

    • Coordinated modification of BnLPAT1 along with other Kennedy pathway enzymes

    • Engineering of transcription factors that regulate multiple lipid biosynthesis genes

    • Balancing carbon allocation between membrane and storage lipids

  • Nutritional quality enhancement:

    • Engineering BnLPAT1 to favor incorporation of specific fatty acids with health benefits

    • Combining with other modifications to produce designer oils

    • Optimizing oil stability while maintaining desirable composition

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.