Recombinant Brassica napus 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 (LPAT2)

Shipped with Ice Packs
In Stock

Description

Function of BnLPAT2

BnLPAT2 is essential for seed oil accumulation in B. napus . It primarily promotes diacylglycerol synthesis, which increases seed oil content (SOC) . Research has shown that manipulating the expression of BnLPAT2 can significantly alter seed oil content and composition .

Experimental Studies and Findings

Several studies have investigated the function of BnLPAT2 using various molecular biology techniques:

  • Overexpression Studies: Overexpression of BnLPAT2 in B. napus leads to an accumulation of lipid droplets and oil bodies in seeds, indicating its role in enhancing oil storage . The expression levels of BnLPAT2 in overexpression lines were found to be significantly higher than in wild-type plants . Biological pathways related to fatty acid/lipid anabolism and carbohydrate metabolism are specifically enriched in the BnLPAT2 overexpression lines .

  • Knockdown and Knockout Studies: Conversely, knockdown and knockout of BnLPAT2 result in a significant decrease in seed oil content . Mutant seeds of Bnlpat2 show an increase in sugar and protein content . The expression levels of the BnLPAT2 gene in knockdown and knockout lines were greatly decreased compared to wild-type plants .

Role in Erucic Acid Production

BnLPAT2 is also relevant in the context of erucic acid (EA) production in Brassicaceae oilseeds . Erucic acid is a monounsaturated fatty acid with various industrial applications. Genetic engineering approaches involving LPAT genes have been explored to enhance erucic acid content in B. napus .

  • Simultaneous introduction of FAE (fatty acid elongase) and LPAT into B. napus can increase erucic acid content, especially when combined with the inhibition of FAD2 gene expression . Suppression of endogenous LPAT2 is a promising strategy for altering the erucic acid content of Brassicaceae oilseeds .

Relationship to Other LPAT Isoforms

B. napus possesses multiple seed-expressed microsomal lysophosphatidic acid acyltransferases (LPAATs) . In addition to BnLPAT2, BnLPAT5 is another key player in seed oil accumulation . While BnLPAT2 preferentially promotes diacylglycerol synthesis, BnLPAT5 tends to boost PA synthesis for membrane lipid generation . Together, BnLPAT2 and BnLPAT5 jointly but differently promote seed oil accumulation in B. napus .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LPAT2; LPAAT2; 1-acyl-sn-glycerol-3-phosphate acyltransferase 2; Lysophosphatidyl acyltransferase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
full length protein
Species
Brassica napus (Rape)
Target Names
LPAT2
Target Protein Sequence
MAMAAAVIVPLGILFFISGLVVNLLQAVCYVLVRPMSKNTYRKINRVVAETLWLELVWIV DWWAGVKIQVFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKS SKFLPVIGWSMWFSEYLFLERNWAKDESTLQSGLQRLNDFPRPFWLALFVEGTRFTEAKL KAAQEYAASSELPVPRNVLIPRTKGFVSAVSNMRSFVPAIYDMTVAIPKTSPPPTMLRLF KGQPSVVHVHIKCHSMKDLPEPEDEIAQWCRDQFVAKDALLDKHIAADTFPGQKEQNIGR PIKSLAVVVSWACLLTLGAMKFLHWSNLFSSWKGIALSAFGLGIITLCMQILIRSSQSER STPAKVAPAKPKDNHQSGPSSQTEVEEKQK
Uniprot No.

Target Background

Function
This recombinant Brassica napus 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 (LPAT2) catalyzes the conversion of lysophosphatidic acid (LPA) to phosphatidic acid by incorporating an acyl moiety at the sn-2 position.
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the functional role of LPAT2 in Brassica napus?

LPAT2 in Brassica napus performs an essential cellular function by controlling the conversion of 1-acyl-sn-glycerol-3-phosphate to phosphatidic acid, which serves as a key intermediate in the synthesis of membrane, signaling, and storage lipids . It belongs to a sub-family of plant LPAATs that constitute a large gene family of lysophospholipid acyltransferases involved in glycerolipid synthesis and membrane lipid remodeling . The enzyme plays a critical role in lipid metabolism pathways and contributes to the determination of lipid acyl composition in developing seeds.

Unlike some other LPAAT isozymes that show tissue-specific expression patterns, LPAT2 appears to be expressed ubiquitously across different plant tissues, suggesting its fundamental importance for general cellular function. Based on studies in the related species Arabidopsis thaliana, LPAT2 is likely the primary enzyme responsible for this reaction in most plant tissues.

Where is LPAT2 localized within plant cells?

LPAT2 is predominantly localized in the endoplasmic reticulum (ER). Evidence from studies in Arabidopsis thaliana demonstrates that LPAT2 colocalizes with calreticulin, an established ER marker protein . This localization has been confirmed through multiple experimental approaches:

  • Immunofluorescence microscopy in tapetum cells (which lack interfering autofluorescent chloroplasts) shows clear colocalization of LPAT2 with calreticulin .

  • Subcellular fractionation experiments further support ER localization, with LPAT2 and calreticulin co-fractionating in the 100k-g (microsomes) and 10k-g pellets .

The ER localization of LPAT2 is consistent with its role in membrane lipid synthesis, as the ER is a major site for phospholipid biosynthesis in plant cells. Interestingly, immunofluorescence studies reveal that while LPAT2 predominantly localizes to the ER, there are small regions in the ER that are not occupied by either LPAT2 or calreticulin, which reaffirms the presence of specialized subdomains within the ER .

How is LPAT2 expressed across different developmental stages in Brassica napus?

In Brassica napus, LPAT2 appears to be expressed in various tissues throughout development. While the search results don't provide comprehensive expression data specifically for Brassica napus LPAT2, studies in Arabidopsis thaliana (a close relative) show that LPAT2 transcripts are present in all major plant organs including siliques, inflorescences, rosette leaves, stems, and roots . LPAT2 protein was detected as a single protein band in total extracts of all examined Arabidopsis organs, confirming its ubiquitous expression pattern .

Importantly, antibodies against Arabidopsis LPAT2 also recognized BnLPAT2 in Brassica napus anthers, indicating conservation of the protein structure between species . This suggests that the expression pattern of LPAT2 in Brassica napus likely parallels the ubiquitous pattern observed in Arabidopsis.

Unlike other LPAAT family members that show more specialized expression patterns (such as LPAT3, which is predominantly expressed in pollen), LPAT2 appears to maintain consistent expression across tissues, highlighting its fundamental role in cellular lipid metabolism.

How does LPAT2 differ functionally from other LPAAT isozymes in Brassica napus?

Brassica napus possesses several distinct LPAAT isozymes with differing expression patterns and potentially specialized functions. The following distinguishing characteristics set LPAT2 apart from other LPAAT enzymes:

  • Expression pattern: While LPAT2 shows ubiquitous expression across tissues, other LPAATs like BAT1.5 and BAT1.13 appear to have more tissue-specific expression profiles, particularly in developing seeds . BAT1.3, another LPAAT in Brassica napus, shows predominant expression during mid-stages of embryo development .

  • Evolutionary origin: Genomic analysis suggests different evolutionary histories for these enzymes. For example, BAT1.5 has been retained after genome duplication as a consequence of subfunctionalization of the gene encoding the ubiquitously expressed Kennedy pathway enzyme BAT1.13 .

  • Substrate specificity: Recombinant LPAT2 expressed in bacteria and yeast exhibits higher activity toward 18:1-CoA than 16:0-CoA . This substrate preference may contribute to the specific acyl composition of membrane and storage lipids in different tissues.

  • Gene dosage sensitivity: Analysis of LPAAT genes suggests they exhibit gene dosage sensitivity, meaning that precise control of their expression levels is crucial for normal development and function . The pattern of retention or loss of LPAAT genes after polyploidization or segmental duplication is consistent with a model of balanced gene drive .

These differences suggest that while LPAT2 serves a fundamental housekeeping role in lipid metabolism, other LPAAT isozymes may have evolved specialized functions in specific tissues or developmental stages, particularly in seed development and oil accumulation.

What approaches are effective for expressing and purifying functional recombinant Brassica napus LPAT2?

Expression and purification of functional recombinant LPAT2 presents several challenges due to its membrane-associated nature. Based on the search results, the following methodological approaches have proven successful:

  • Bacterial expression systems:

    • The full-length open reading frame of LPAT2 can be inserted into expression vectors such as pQE, which contains the T5 promoter transcription-translation system .

    • Expression in E. coli JC201, a temperature-sensitive mutant of LPAT, allows for functional complementation assays .

    • A significant challenge is that LPAT2 strongly inhibits bacterial growth, which is common when expressing eukaryotic membrane proteins in bacteria .

    • Expression conditions must be carefully optimized; using low concentrations of IPTG (0.2 mM) for induction helps minimize toxicity .

  • Yeast expression systems:

    • Recombinant LPAT2 has been successfully expressed in yeast systems, which may provide a more suitable eukaryotic environment for proper folding and processing .

    • Antibodies against the C-terminus of LPAT2 can detect the recombinant protein expressed in yeast, confirming successful expression .

  • Functional validation methods:

    • In vivo functional complementation: LPAT2 activity can be verified by its ability to complement the growth defect of E. coli JC201 at the non-permissive temperature (42°C) .

    • In vitro enzyme assays: Membrane fractions from cells expressing recombinant LPAT2 can be used to measure enzyme activity with different acyl-CoA substrates .

When purifying LPAT2, it's essential to maintain an appropriate membrane or detergent environment to preserve enzyme activity, as it is an integral membrane protein of the ER.

How do mutations in LPAT2 affect plant reproduction and development?

The critical role of LPAT2 in plant reproduction has been demonstrated through studies of mutant phenotypes, particularly in Arabidopsis thaliana. Based on the available information, mutations in LPAT2 have profound effects:

  • Female gametophyte lethality:

    • A null allele (lpat2) with T-DNA insertion into LPAT2 causes lethality specifically in the female gametophyte but not in the male gametophyte .

    • Heterozygous mutants (LPAT2/lpat2) produce shorter siliques containing approximately half normal seeds and half remnants of aborted ovules in a 1:1 ratio, indicative of female gametophyte-specific defects .

    • Microscopic analysis reveals that the lpat2 female gametophyte begins to differ from wild type at the four-cell stage, with the central cell of the lpat2 mutant containing numerous large starch grains instead of the abundant ER observed in wild type .

  • Developmental abnormalities:

    • The heterozygous mutant plants (LPAT2/lpat2) exhibit minimal altered vegetative phenotype but have slightly shorter rosette leaves compared to wild type .

    • Siliques of heterozygous plants are approximately two-thirds the length of those in wild type .

  • Genetic rescue experiments:

    • LPAT2-cDNA driven by an LPAT2 promoter functionally complements lpat2 in transformed heterozygous mutants .

    • Interestingly, LPAT3-cDNA driven by the LPAT2 promoter can rescue the lpat2 female gametophytes to allow fertilization to occur but not to full embryo maturation, suggesting partial functional overlap but distinct roles .

The specific lethality in female gametophytes is likely due to LPAT2 being the only LPAT expressed in female gametophytes, while the male gametophyte (pollen) expresses the redundant LPAT3 which can compensate for the loss of LPAT2 .

What methods are used to assess LPAT2 enzyme activity and substrate specificity?

Several methodological approaches have been employed to characterize LPAT2 enzyme activity and substrate specificity:

How does LPAT2 contribute to seed oil accumulation in Brassica napus?

The role of LPAT2 in seed oil accumulation in Brassica napus is complex and intertwined with other LPAATs expressed in developing seeds. Based on the available information:

What antibodies and detection methods are effective for LPAT2 analysis?

Based on the research results, the following approaches have proven effective for LPAT2 detection and analysis:

  • Antibody development:

    • Antibodies against a synthetic peptide corresponding to the C-terminus of LPAT2 have been successfully raised .

    • This C-terminal sequence in LPAT2 (or a similar version) is absent in LPAT3-5 and all other Arabidopsis proteins, making it highly specific .

    • These antibodies react with LPAT2 but not LPAT3-5 synthesized in transformed yeast, confirming their specificity .

  • Western blot analysis:

    • Anti-LPAT2 antibodies detect LPAT2 as a single protein band by SDS-PAGE immunoblotting in total extracts of various Arabidopsis organs .

    • Notably, anti-LPAT2 antibodies also recognize BnLPAT2 in Brassica napus anthers, indicating cross-reactivity between these closely related species .

  • Immunofluorescence microscopy:

    • For subcellular localization studies, tapetum cells of Arabidopsis and Brassica have been used effectively because they lack interfering autofluorescent chloroplasts .

    • Double labeling with antibodies against LPAT2 and the ER marker calreticulin shows colocalization in the ER .

    • This approach can reveal specialized subdomains within the ER, as small regions were found to be occupied by neither LPAT2 nor calreticulin .

  • Subcellular fractionation:

    • Subcellular fractionation of Brassica sporophytic anther extract followed by SDS-PAGE and immunoblotting provides complementary evidence of LPAT2 localization .

    • LPAT2 and calreticulin were found to colocalize in the 100k-g (microsomes) and 10k-g pellets, consistent with ER localization .

These methods provide a comprehensive toolkit for analyzing LPAT2 expression, localization, and function in both Arabidopsis and Brassica species.

How can gene expression of LPAT2 be effectively analyzed in different tissues?

Multiple complementary approaches have been used to analyze LPAT2 gene expression across different tissues:

  • RT-PCR analysis:

    • RT-PCR has been used successfully to detect LPAT2 transcripts in various organs including siliques, inflorescences, rosette leaves, stems, roots, developing embryos, and seedlings .

    • This method provides a reliable qualitative assessment of gene expression across different tissues.

  • RNA gel blot analysis:

    • RNA gel blot analysis has been employed to quantitatively compare LPAT2 transcript levels between wild-type and mutant plants .

    • This technique revealed that heterozygous LPAT2/lpat2 mutants contained approximately half the amount of wild-type LPAT2 transcript compared to wild-type plants, as well as detecting a truncated transcript in the mutant .

  • Promoter-reporter gene fusions:

    • The LPAT2 promoter has been fused to the β-glucuronidase (GUS) reporter gene to visualize expression patterns in transgenic plants .

    • This approach provides spatial resolution of gene expression within complex tissues and organs.

  • Transcriptome analysis:

    • Analysis of published transcriptome data, such as that available for Arabidopsis pollen, can provide additional insights into relative expression levels of LPAT2 compared to other LPAATs in specific tissues .

    • For example, transcriptome data confirmed that LPAT3, but not LPAT2, LPAT4, or LPAT5, was abundantly expressed in Arabidopsis pollen .

  • Protein detection:

    • Immunoblotting with specific antibodies provides confirmation that transcript expression correlates with protein accumulation .

    • This is particularly important for proteins like LPAT2 that may be subject to post-transcriptional regulation.

By combining these approaches, researchers can obtain a comprehensive picture of LPAT2 expression patterns at both the transcript and protein levels across different tissues and developmental stages.

How does Brassica napus LPAT2 compare structurally and functionally to orthologs in other plant species?

The structural and functional comparison of LPAT2 across plant species reveals both conservation and species-specific adaptations:

  • Sequence conservation:

    • Antibodies raised against Arabidopsis LPAT2 recognize Brassica napus LPAT2 (BnLPAT2) , indicating significant sequence conservation particularly at the C-terminal region used for antibody generation.

    • This conservation is expected given the close evolutionary relationship between Arabidopsis and Brassica species.

  • Subcellular localization:

    • Similar to Arabidopsis LPAT2, Brassica LPAT2 localizes to the ER as demonstrated by colocalization with calreticulin in tapetum cells .

    • The conservation of subcellular localization suggests preserved functional roles across species.

  • Evolutionary history in polyploids:

    • As a tetraploid, Brassica napus possesses multiple LPAAT genes that have been retained after genome duplication .

    • This retention pattern follows a model of balanced gene drive, suggesting evolutionary pressure to maintain specific gene dosage relationships .

  • Functional conservation:

    • The essential role of LPAT2 in female gametophyte development observed in Arabidopsis likely extends to Brassica napus, though direct experimental evidence from the search results is limited.

    • The presence of tissue-specific LPAAT isozymes in addition to the ubiquitous LPAT2 appears to be a common feature across species, reflecting specialized adaptations for diverse metabolic needs.

  • Substrate preference:

    • LPAT2 expressed in recombinant bacteria and yeast shows higher activity toward 18:1-CoA than 16:0-CoA , a substrate preference that may be conserved across species and contribute to the specific acyl composition of membrane and storage lipids.

While the search results provide limited direct comparative data, the available information suggests substantial conservation of LPAT2 structure and function between Arabidopsis and Brassica napus, with adaptations related to the polyploid nature of Brassica napus.

What role does LPAT2 play in stress responses and environmental adaptation?

While the search results do not directly address the role of LPAT2 in stress responses and environmental adaptation, its function in lipid metabolism suggests potential involvement in these processes:

  • Membrane lipid remodeling:

    • LPAT2 belongs to a family of lysophospholipid acyltransferases involved in glycerolipid synthesis and membrane lipid remodeling .

    • Membrane lipid composition and fluidity adjustments are crucial aspects of plant adaptation to various environmental stresses, including temperature fluctuations, drought, and salinity.

  • Signaling molecule production:

    • Phosphatidic acid, the product of LPAT2 activity, serves not only as a precursor for membrane and storage lipids but also as an important signaling molecule in stress responses .

    • Changes in LPAT2 activity could potentially affect stress signaling pathways through altered phosphatidic acid production.

  • Developmental plasticity:

    • The critical role of LPAT2 in female gametophyte development suggests its potential involvement in reproductive adaptations to environmental conditions.

    • Plants often adjust reproductive strategies in response to stress, and enzymes involved in fundamental aspects of reproductive development may play roles in these adaptations.

  • Interaction with stress-responsive pathways:

    • As a ubiquitously expressed enzyme involved in essential lipid metabolism pathways, LPAT2 likely interfaces with various stress-responsive metabolic adjustments.

    • Changes in carbon partitioning during stress (such as the accumulation of starch observed in lpat2 female gametophytes) may involve altered LPAT2 activity or expression.

Further research specifically addressing how LPAT2 expression, activity, or regulation changes in response to various stresses would be valuable to fully understand its role in environmental adaptation.

What biotechnological applications could leverage LPAT2 engineering in Brassica napus?

Biotechnological applications involving LPAT2 engineering in Brassica napus could target several aspects of plant improvement:

These potential applications would require careful consideration of LPAT2's interactions with other enzymes in lipid metabolism pathways and rigorous testing to ensure that modifications produce the desired effects without unexpected consequences.

What methods could improve the functional expression of recombinant LPAT2 for structural studies?

Improving functional expression of recombinant LPAT2 for structural studies presents significant challenges due to its membrane-associated nature. Several approaches could potentially enhance expression and facilitate structural analysis:

  • Expression system optimization:

    • The search results indicate that LPAT2 strongly inhibits bacterial growth , suggesting that alternative expression hosts may be beneficial.

    • Eukaryotic expression systems like insect cells (baculovirus) or mammalian cells might provide a more suitable environment for proper folding and processing.

    • Cell-free expression systems could also be explored, particularly those optimized for membrane proteins.

  • Protein engineering:

    • Creating fusion constructs with solubility-enhancing tags (such as MBP or SUMO) might improve expression and solubility.

    • Truncation constructs removing potential flexible regions while retaining the catalytic core could enhance protein stability for structural studies.

    • Introduction of mutations to improve stability without compromising function could be identified through directed evolution approaches.

  • Membrane mimetics for purification and crystallization:

    • Various detergents should be systematically screened to identify optimal conditions for extracting active LPAT2 from membranes.

    • Nanodiscs, amphipols, or lipid cubic phase techniques have proven successful for structural studies of other membrane proteins and could be applied to LPAT2.

    • Lipid composition optimization may be critical, as LPAT2 naturally functions in the ER membrane environment.

  • Structural determination approaches:

    • Beyond X-ray crystallography, cryo-electron microscopy (cryo-EM) has revolutionized membrane protein structural biology and could be particularly suitable for LPAT2.

    • Nuclear magnetic resonance (NMR) spectroscopy, particularly solid-state NMR, could provide structural insights even without crystals.

    • Computational approaches including homology modeling and molecular dynamics simulations could complement experimental structural data.

  • Functional validation methods:

    • Activity assays using different substrates should be employed throughout the optimization process to ensure that structural insights are derived from functionally relevant protein conformations.

    • Thermal shift assays could help identify stabilizing conditions and ligands for structural studies.

These approaches would need to be systematically explored and likely combined to overcome the challenges inherent in structural studies of membrane-associated enzymes like LPAT2.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.