Recombinant Brassica napus Major oleosin NAP-II

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Major oleosin NAP-II; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-175
Protein Length
full length protein
Species
Brassica napus (Rape)
Target Protein Sequence
RRDQYPRDRDQYSMIGRDRDKYSMIGRDRDQYNMYGRDYSKSRQIAKAVTAVTAGGSLLV LSSLTLVGTVIALTVATPLLVIFSPILVPALITVALLITGFLSSGGFGIAAITVFSWIYK YATGEHPQGSDKLDSARMKLGGKVQDMKDRAQYYGQQQTGGEDDRDRTRGTQHTT
Uniprot No.

Target Background

Function

Major oleosin NAP-II likely plays a structural role in stabilizing lipid bodies during seed desiccation by preventing oil coalescence. It probably interacts with both lipid and phospholipid components of lipid bodies. It may also provide recognition signals for specific lipase binding during lipolysis in seedling growth.

Database Links

UniGene: Bna.1245

Protein Families
Oleosin family
Subcellular Location
Lipid droplet. Membrane; Multi-pass membrane protein. Note=Surface of oil bodies. Oleosins exist at a monolayer lipid/water interface.

Q&A

What are oleosins and what is their role in Brassica napus?

Oleosins are the most important structural proteins found in oil bodies of oilseed plants like Brassica napus (rapeseed). They play a critical role in preventing the fusion of oil bodies and maintaining oil body size during seed development . Rapeseed stores lipids in the form of oil bodies, and these oil bodies are surrounded by oleosins which form a stabilizing monolayer at the oil-water interface . The appropriate expression of oleosin genes is essential for proper oil accumulation in the seeds, making them crucial targets for studying oil content regulation in rapeseed.

How many oleosin genes have been identified in the Brassica napus genome?

Recent genome-wide analyses have identified between 48-53 oleosin genes in the Brassica napus genome . These genes are distributed across different chromosomes and can be classified into four distinct lineages: T, U, SH, and SL . This extensive gene family highlights the importance of oleosins in rapeseed biology. Each lineage shows specific patterns of expression and different functional characteristics, suggesting evolutionary specialization within the oleosin gene family.

How are oleosin genes classified and organized in Brassica napus?

Oleosin genes in Brassica napus are typically classified into four evolutionary lineages:

  • T lineage: Shows high expression levels during flowering stage but relatively low expression in other tissues

  • U lineage: Expression gradually increases from seed stage 3 to 10, suggesting involvement in seed development

  • SH lineage (high-molecular-weight oleosins): Expression increases during seed development

  • SL lineage (low-molecular-weight oleosins): Expression increases during seed development

These classifications are based on sequence homology, structural features, and expression patterns. The SH and SL lineages in particular have been found to be highly expressed during seed development, indicating their importance in oil accumulation processes .

What molecular mechanisms underlie the differential expression of oleosins in high vs. low oil content Brassica napus varieties?

The differential expression of oleosin genes between high-oil-content (HOC) and low-oil-content (LOC) Brassica napus varieties involves complex regulatory networks. Research has identified six key oleosin genes (BnOLEO3-C09, BnOLEO4-A02, BnOLEO4-A09, BnOLEO2-C04, BnOLEO1-C01, and BnOLEO7-A03) that consistently show higher expression in HOC accessions compared to LOC accessions across different developmental stages (25, 35, and 45 days after pollination) and environmental conditions .

This differential expression is likely regulated through various cis-acting elements in the promoter regions of oleosin genes, including light-responsive elements (G-box, Box 4, GT1-motif), phytohormone-responsive elements (ABRE, CGTCA, TGACG-motifs), and stress-related elements (ARE, TC-rich repeats, LTR, MBS) . The presence of these elements indicates that oleosin expression is responsive to environmental signals, hormonal regulation, and developmental cues, which collectively influence oil accumulation in seeds.

How do nucleotide variations in oleosin genes affect seed oil content in Brassica napus?

Regional association analysis of 50 re-sequenced rapeseed accessions has revealed that nucleotide variations in specific oleosin gene regions, particularly BnOLEO1-C01 and BnOLEO7-A03, are significantly correlated with phenotypic variations in seed oil content . The BnOLEO1-C01-Hap1 and BnOLEO7-A03-Hap1 haplotypes correspond to accessions with higher seed oil contents compared to other haplotype alleles .

Notably, the haplotype region on the A03 chromosome, where BnOLEO7-A03 is located, overlaps with a previously reported quantitative trait locus (QTL) for oil content . These genetic variations likely affect protein structure, stability, or interaction capabilities of the oleosin proteins, ultimately influencing oil body formation and oil accumulation efficiency in the seeds.

What is the co-expression network of oleosin genes in Brassica napus and how does it impact seed oil accumulation?

Co-expression network analysis has revealed that oleosin genes in Brassica napus form a complex molecular network with genes involved in:

  • Lipid/fatty acid metabolism

  • Transcription factors

  • Lipid transport

  • Carbohydrate metabolism

This network demonstrates that oleosins do not function in isolation but are integrated into broader metabolic and regulatory pathways controlling oil accumulation. The co-expression patterns suggest that oleosin genes are coordinated with genes responsible for synthesizing fatty acids, assembling triacylglycerols (TAGs), and transporting lipids to oil bodies. Understanding these connections helps explain how oleosin expression patterns contribute to the final oil content and composition in rapeseed.

What are the most effective methods for isolating and characterizing recombinant Brassica napus oleosins?

For effective isolation and characterization of recombinant Brassica napus oleosins, researchers should follow a multi-step approach:

  • Gene cloning and vector construction: Identify the target oleosin sequence (e.g., NAP-II) from genomic data, design specific primers, amplify the coding sequence, and clone it into a suitable expression vector .

  • Heterologous expression: Transform the construct into an expression system such as Escherichia coli, yeast, or plant cells. For plant-specific post-translational modifications, Arabidopsis or Nicotiana benthamiana systems are often preferred .

  • Protein purification: Extract oil bodies by homogenization and centrifugation, then isolate oleosins using detergents to disrupt the oil body membrane, followed by chromatography techniques (ion exchange, hydrophobic interaction, or size exclusion) .

  • Characterization techniques:

    • Western blotting with specific antibodies

    • Mass spectrometry for protein identification and modification analysis

    • Circular dichroism for secondary structure determination

    • Functional assays for oil body stability and size regulation

These methods have been successfully employed to study the structure-function relationships of oleosins and their impact on oil body morphology and stability.

How can transgenic approaches be used to study oleosin function in Brassica napus?

Transgenic approaches offer powerful tools for studying oleosin function in Brassica napus:

  • Overexpression studies: Clone oleosin genes (such as BnOLEO1, BnOLEO2, BnOLEO3, BnOLEO4) under strong seed-specific promoters and transform into Arabidopsis or Brassica napus . This approach has demonstrated that overexpression can increase seed oil content, alter oil body size, modify fatty acid profiles, and affect seed size and weight .

  • RNAi or CRISPR-Cas9 for gene silencing/knockout: To understand the consequences of reduced oleosin expression, RNA interference or CRISPR-Cas9 can be used to downregulate or knock out specific oleosin genes .

  • Promoter-reporter fusions: Fuse oleosin gene promoters with reporter genes (GFP, GUS) to study spatial and temporal expression patterns during seed development .

  • Site-directed mutagenesis: Introduce specific mutations in the conserved domains of oleosins to study structure-function relationships .

  • Phenotypic analysis of transgenic plants:

    • Microscopic analysis of oil body size and distribution

    • Determination of oil content using gas chromatography

    • Fatty acid profiling

    • Seed weight and morphology analysis

These transgenic approaches provide direct evidence of oleosin function and their impact on oil accumulation and seed development.

What techniques are most appropriate for analyzing oleosin expression patterns during rapeseed development?

Several complementary techniques are optimal for analyzing oleosin expression patterns during rapeseed development:

  • RNA-Seq: This high-throughput approach allows comprehensive profiling of all oleosin genes simultaneously at different developmental stages. RNA-seq has been successfully used to identify differentially expressed oleosins between high-oil-content and low-oil-content rapeseed varieties at 25, 35, and 45 days after pollination (DAP) .

  • Quantitative real-time PCR (qRT-PCR): This technique provides precise quantification of expression levels for specific oleosin genes. qRT-PCR has been used to validate RNA-seq results and confirm expression patterns of key oleosin genes such as BnOLEO3-C09, BnOLEO4-A02, BnOLEO4-A09, BnOLEO2-C04, BnOLEO1-C01, and BnOLEO7-A03 .

  • In situ hybridization: For tissue-specific localization of oleosin mRNA within the seed.

  • Promoter-reporter assays: To visualize the spatial and temporal activity of oleosin promoters during seed development.

  • Immunolocalization: Using specific antibodies to detect oleosin proteins in tissue sections, providing information about protein localization and abundance.

  • Western blotting: For quantification of oleosin protein levels during seed development.

To ensure robust results, researchers should collect samples at multiple developmental stages (early, mid, and late seed development) and normalize expression data with appropriate reference genes that show stable expression across development stages.

How should researchers interpret changes in oleosin expression in relation to oil content and composition?

When interpreting changes in oleosin expression in relation to oil content and composition, researchers should consider several key relationships:

What statistical approaches are most appropriate for analyzing oleosin gene haplotype associations with oil content traits?

When analyzing oleosin gene haplotype associations with oil content traits, researchers should employ the following statistical approaches:

  • Regional association analysis: This approach has successfully identified associations between nucleotide variations in BnOLEO1-C01 and BnOLEO7-A03 gene regions and phenotypic variations in seed oil content . The analysis should include:

    • SNP (Single Nucleotide Polymorphism) identification and filtering

    • Haplotype construction

    • Linkage disequilibrium analysis

    • Association testing controlling for population structure

  • Mixed linear models (MLM): These models account for both population structure (Q) and kinship (K) to reduce false positives in association studies. The Q+K model is particularly useful for association mapping in rapeseed populations with complex genetic backgrounds.

  • Multiple testing correction: Apply methods such as Bonferroni correction or False Discovery Rate (FDR) to control for the increased probability of false positives when testing multiple SNPs.

  • Effect size estimation: Calculate the proportion of phenotypic variance explained by each significant haplotype to determine its relative importance.

  • Cross-validation: Use techniques like k-fold cross-validation to assess the robustness of identified associations.

  • Multi-locus models: Consider epistatic interactions between different oleosin genes or between oleosins and other oil-related genes.

  • Environmental interaction analysis: Test whether haplotype effects are consistent across different environments or show genotype-by-environment interactions.

The analysis of 50 re-sequenced rapeseed accessions demonstrated that specific haplotypes (BnOLEO1-C01-Hap1 and BnOLEO7-A03-Hap1) corresponded to accessions with higher seed oil contents , providing valuable genetic markers for breeding programs.

How can researchers effectively analyze the co-expression networks of oleosin genes to identify key regulatory relationships?

To effectively analyze co-expression networks of oleosin genes and identify key regulatory relationships, researchers should employ the following approaches:

  • Weighted Gene Co-expression Network Analysis (WGCNA): This method identifies modules of highly correlated genes and relates them to external traits like oil content. WGCNA has revealed that oleosin genes are directly linked to lipid/fatty acid metabolism, transcription factors, lipid transport, and carbohydrate genes .

  • Differential co-expression analysis: Compare co-expression networks between high and low oil content varieties to identify connections that differ between these phenotypes.

  • Network visualization tools: Use tools like Cytoscape to visualize complex relationships between oleosins and other genes. Focus on:

    • Central hub genes that connect multiple pathways

    • Transcription factors that may regulate multiple oleosin genes

    • Metabolic enzymes directly connected to oleosin expression

  • Enrichment analysis: Perform Gene Ontology (GO) or KEGG pathway enrichment analysis on genes co-expressed with oleosins to identify biological processes associated with oleosin function.

  • Bayesian network inference: Use probabilistic models to infer causal relationships and directionality in the network.

  • Integration with ChIP-seq or DNA affinity purification sequencing (DAP-seq): Identify direct binding of transcription factors to oleosin gene promoters to validate predicted regulatory relationships.

  • Time-series analysis: Analyze the temporal dynamics of the co-expression network during seed development to identify sequential activation of different modules.

Research has shown that oleosin genes form molecular networks with genes involved in lipid synthesis, transport, and metabolism, suggesting coordinated regulation of oil body formation and oil accumulation in rapeseed .

What are the most promising approaches for engineering improved oleosin variants for enhanced oil production in Brassica napus?

Several promising approaches exist for engineering improved oleosin variants to enhance oil production in Brassica napus:

  • Targeted overexpression of beneficial oleosins: Overexpression of specific oleosins (such as BnOLEO1, BnOLEO2, and BnOLEO4) that have demonstrated positive effects on seed oil content, oil body size, and beneficial fatty acid profiles . Seed-specific promoters should be used to avoid potential negative effects in vegetative tissues.

  • CRISPR-Cas9 genome editing: Precise modification of key oleosin genes identified through association studies, particularly BnOLEO1-C01 and BnOLEO7-A03, to incorporate favorable alleles associated with higher oil content .

  • Promoter engineering: Modification of oleosin gene promoters to optimize expression timing and levels during seed development. Incorporation of additional cis-regulatory elements related to light response (G-box, Box 4, GT1-motif) and hormone response (ABRE, CGTCA-motifs) could enhance expression .

  • Domain swapping and chimeric oleosins: Creation of chimeric oleosins combining functional domains from different oleosin lineages to potentially create superior variants with enhanced oil body stabilization properties.

  • Co-expression of oleosin with other oil body proteins: Coordinated expression of oleosins with other oil body proteins like caleosins and steroleosins might enhance oil body stability and functionality.

  • Modification of oleosin post-translational regulation: Engineering oleosin variants resistant to degradation or with optimized phosphorylation sites could potentially extend their functional lifetime in developing seeds.

  • Exploitation of natural variation: Utilization of the natural variation in oleosin sequences identified through the regional association analysis of 50 re-sequenced rapeseed accessions to identify and incorporate favorable haplotypes .

These approaches, particularly when combined with high-throughput phenotyping and multi-omics analyses, hold significant promise for developing rapeseed varieties with enhanced oil production capabilities.

What remains unknown about the structure-function relationship of oleosins in oil body formation and stability?

Despite significant advances in oleosin research, several aspects of the structure-function relationship remain poorly understood:

  • Molecular mechanisms of oil body size regulation: Although oleosins are known to affect oil body size, the precise molecular mechanisms by which they prevent oil body fusion and regulate size are not fully elucidated. Research has shown that oil body size can be affected by oleosin overexpression, but the relationship is complex, with some oleosin genes (like BnaOLE1) showing different effects than others .

  • Isoform-specific functions: The functional specialization of different oleosin isoforms from the four lineages (T, U, SH, SL) remains largely unknown. Why has rapeseed maintained such a large oleosin gene family (48-53 genes) if functional redundancy exists?

  • Protein-protein interactions: The interactions between different oleosin isoforms and between oleosins and other oil body proteins (caleosins, steroleosins) are not well characterized. These interactions may be crucial for oil body assembly and maintenance.

  • Lipid specificity: Whether different oleosin isoforms have preferences for specific lipid compositions or fatty acid profiles remains unknown. The observation that oleosin overexpression can alter fatty acid composition suggests potential lipid-specific interactions .

  • Post-translational modifications: The role of phosphorylation, ubiquitination, and other post-translational modifications in regulating oleosin function and turnover requires further investigation.

  • Environmental responsiveness: How environmental factors influence oleosin expression and function through the various cis-acting elements identified in their promoters (light-responsive, hormone-responsive, and stress-responsive elements) remains to be fully explored .

  • Structural determinants of oil body targeting: The precise structural features that determine correct targeting and insertion of oleosins into the oil body phospholipid monolayer need further clarification.

Addressing these knowledge gaps will require advanced structural biology techniques, including cryo-electron microscopy of oil bodies, advanced imaging of oleosin dynamics, and systematic mutagenesis studies of oleosin functional domains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.