Recombinant Brassica napus NADH-ubiquinone oxidoreductase chain 3 (ND3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your preparation.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
ND3; NAD3; NADH-ubiquinone oxidoreductase chain 3; NADH dehydrogenase subunit 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Brassica napus (Rape)
Target Names
ND3
Target Protein Sequence
MMLEFAPIFIYLVISLLVSLILLGVPFLFASNSSTYPEKLSAYECGFDPFGDARSRFDIR FYLVSILFLIFDLEVTFFFPWAVSLNKIDLFGFWSMMAFLFILTIGFLYEWKRGALDWE
Uniprot No.

Target Background

Function

A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), it's considered part of the minimal assembly essential for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be its immediate electron acceptor.

Database Links

KEGG: bna:4237970

Protein Families
Complex I subunit 3 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is NADH-ubiquinone oxidoreductase chain 3 (ND3) and what role does it play in Brassica napus?

NADH-ubiquinone oxidoreductase chain 3 (ND3) is one of the mitochondrially encoded subunits of Complex I in the electron transport chain of Brassica napus. Similar to what has been observed in bovine heart mitochondria, Complex I likely contains approximately 41 subunits, with seven encoded in mitochondrial DNA, including ND3 . This protein plays a critical role in the first step of electron transfer from NADH to ubiquinone and contributes to proton translocation across the inner mitochondrial membrane. In Brassica species, ND3 functions within the membrane arm of Complex I and is essential for maintaining energy metabolism under various environmental conditions.

How is the ND3 gene organized in the Brassica napus mitochondrial genome?

The ND3 gene in B. napus is encoded within the mitochondrial genome, which follows a different inheritance pattern than nuclear genes. Based on genomic studies of B. napus cultivars like 'ZS11', the mitochondrial genome organization shows specific characteristics that reflect its evolutionary history . The gene structure typically includes coding regions without introns, flanked by mitochondrial promoter elements and regulatory regions. The arrangement of mitochondrial genes in B. napus has been shaped by its allotetraploid nature, resulting from hybridization between B. rapa and B. oleracea approximately 6700 years ago . This genomic organization influences the expression and regulation of mitochondrial genes including ND3.

What are the recommended protocols for isolating intact mitochondria from Brassica napus tissues?

Mitochondrial isolation from B. napus tissues requires careful methodology to preserve organelle integrity and function. The recommended protocol includes:

  • Tissue homogenization in isolation buffer (0.3 M mannitol, 50 mM HEPES, 1 mM EDTA, 0.1% BSA, pH 7.4)

  • Filtration through miracloth to remove debris

  • Differential centrifugation (1,000 × g for 10 min to remove debris, followed by 12,000 × g for 15 min to pellet mitochondria)

  • Purification through Percoll gradient centrifugation (18%, 23%, and 40% Percoll layers)

  • Quality assessment through respiratory control ratio measurements and marker enzyme assays

This approach minimizes contamination with other cellular components while maintaining mitochondrial function, essential for subsequent analysis of Complex I and its subunits including ND3.

What expression systems are suitable for producing recombinant Brassica napus ND3?

Several expression systems can be used for recombinant ND3 production, each with distinct advantages:

Expression SystemAdvantagesLimitationsYieldPost-translational Modifications
E. coli (with solubility tags)Rapid growth, high yield, cost-effectiveLimited post-translational modifications, inclusion body formationHighMinimal
Yeast (S. cerevisiae, P. pastoris)Eukaryotic processing, higher solubilityLonger production time, different codon usageModeratePartial
Baculovirus-insect cellSuperior folding of membrane proteinsComplex setup, higher costModerate-HighGood
Plant-based expression (N. benthamiana)Native-like environment for plant proteinsTime-consuming, variable yieldsLow-ModerateExcellent

For reliable production of functional ND3, a baculovirus-insect cell system often provides the best balance between yield and proper folding of this hydrophobic membrane protein.

What analytical techniques should be used to confirm the identity and purity of recombinant ND3?

Verification of recombinant ND3 identity and purity requires multiple analytical approaches:

  • SDS-PAGE and western blotting with ND3-specific antibodies to confirm protein size and immunoreactivity

  • Mass spectrometry (MS) for peptide mass fingerprinting and sequence verification

  • Circular dichroism (CD) spectroscopy to assess secondary structure integrity

  • Size exclusion chromatography to evaluate oligomeric state and aggregation

  • N-terminal sequencing to confirm proper processing of the recombinant protein

These techniques should be combined to establish conclusive evidence of protein identity and quality before proceeding with functional studies.

How can researchers effectively study the integration of recombinant ND3 into functional Complex I?

Studying the integration of recombinant ND3 into Complex I requires sophisticated approaches:

  • Blue native PAGE followed by activity staining can visualize assembled complexes and assess ND3 incorporation

  • Protein crosslinking coupled with MS identifies interaction partners of ND3 within Complex I

  • Proteoliposome reconstitution with purified components allows functional assessment of Complex I with integrated recombinant ND3

  • Cryogenic electron microscopy can reveal structural details of properly assembled Complex I containing recombinant ND3

  • Import assays using isolated mitochondria can track the efficiency of ND3 incorporation into native complexes

These methodologies provide complementary information about both structural integration and functional consequences of recombinant ND3 in Complex I assembly.

What are the most sensitive methods for measuring Complex I activity in preparations containing recombinant ND3?

Several sensitive assays can evaluate Complex I activity after integration of recombinant ND3:

  • Spectrophotometric assays measuring NADH oxidation coupled to artificial electron acceptors (absorbance decrease at 340 nm)

  • Oxygen consumption measurements using high-resolution respirometry to assess electron flow through the respiratory chain

  • Proton-pumping assays using pH-sensitive fluorescent dyes to measure the primary function of Complex I

  • ROS production measurements to assess potential electron leakage using fluorescent probes

  • Membrane potential assays using potentiometric dyes to evaluate the electrochemical gradient formation

The integration of multiple measurement approaches provides a comprehensive picture of how recombinant ND3 affects various aspects of Complex I function.

How can researchers investigate the impact of post-translational modifications on ND3 function?

Post-translational modifications (PTMs) of ND3 can significantly impact its function. Research approaches include:

  • Mass spectrometry-based PTM mapping to identify specific modification sites

  • Site-directed mutagenesis to create modification-mimicking or modification-resistant variants

  • Chemical treatments to selectively modify specific residues followed by activity measurements

  • Phosphoproteomic analysis comparing ND3 modifications under different physiological conditions

  • In vitro enzymatic modification followed by functional assessment

These approaches help establish causal relationships between specific modifications and functional outcomes in Complex I activity.

What factors should be considered when designing experiments to compare ND3 functionality across different Brassica species?

Comparative studies of ND3 across Brassica species require careful experimental design:

  • Selection of genetically well-characterized lines from each species (e.g., 'ZS11' for B. napus, well-characterized lines of B. juncea and B. oleracea)

  • Standardization of growth conditions to minimize environmental variation

  • Age-matched sampling to account for developmental differences

  • Inclusion of biological and technical replicates (minimum n=5 biological replicates)

  • Normalization strategies that account for differences in mitochondrial content

  • Statistical approaches appropriate for multi-species comparisons (e.g., nested ANOVA)

This experimental design allows for robust inter-species comparisons while minimizing confounding variables that could obscure true biological differences in ND3 function.

How should researchers design controls for experiments involving site-directed mutagenesis of recombinant ND3?

Site-directed mutagenesis studies of ND3 require comprehensive controls:

  • Wild-type ND3 expressed and purified under identical conditions as mutant variants

  • Conservative mutations (similar amino acid substitutions) to distinguish between amino acid identity versus property effects

  • Multiple mutations at the same site to establish structure-function relationships

  • Negative controls with mutations in non-critical regions to control for general perturbation effects

  • Positive controls with mutations in known functional residues to validate assay sensitivity

This control strategy establishes confidence in the specificity of observed effects and strengthens mechanistic interpretations of mutational studies.

What approaches can determine the precise role of ND3 in proton pumping and electron transfer within Complex I?

Determining ND3's specific contribution to Complex I function requires specialized techniques:

  • Reconstitution of Complex I with wild-type versus mutant ND3 in proteoliposomes to measure proton translocation

  • Site-specific labeling with environmentally sensitive probes to detect conformational changes during catalysis

  • Freeze-quench EPR spectroscopy to capture electron transfer intermediates

  • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions involved in energy transduction

  • Computational molecular dynamics simulations to model ND3's role in proton channels

These approaches provide mechanistic insights into how ND3 contributes to the coupling of electron transfer to proton translocation in Complex I.

How can researchers investigate the interaction between ND3 and other Complex I subunits in Brassica napus?

Protein-protein interaction studies for ND3 require specialized approaches for membrane proteins:

  • Chemical crosslinking followed by mass spectrometry to identify neighboring subunits

  • Split-reporter assays (modified for membrane proteins) to verify specific interactions

  • Co-immunoprecipitation with subunit-specific antibodies to identify stable interaction partners

  • Surface plasmon resonance with detergent-solubilized components to measure binding affinities

  • Proximity labeling approaches (e.g., BioID) to identify the interaction neighborhood of ND3

These complementary methods overcome the challenges associated with studying interactions among hydrophobic membrane proteins within Complex I.

What are common challenges in expressing and purifying recombinant ND3 and how can they be addressed?

Common challenges and solutions for recombinant ND3 work include:

ChallengeCauseSolutionSuccess Indicator
Poor expressionProtein toxicity, codon biasUse inducible systems, optimize codons, lower temperatureDetectable expression on western blot
Inclusion body formationImproper foldingAdd solubility tags, use specialized strains, optimize detergentsIncreased soluble fraction
Low purityNon-specific bindingOptimize binding/washing conditions, use tandem purification>90% purity on SDS-PAGE
Protein aggregationHydrophobic interactionsInclude stabilizing agents, optimize detergent:protein ratioMonodisperse peak on size exclusion
Loss of functionDenaturation during purificationGentle purification methods, validate with activity assaysPreserved electron transfer activity

Systematic optimization addressing these challenges significantly improves recombinant ND3 quality and experimental outcomes.

How can researchers distinguish between issues arising from recombinant ND3 versus problems with other Complex I components?

Discriminating between ND3-specific and other Complex I issues requires strategic approaches:

  • Complementation studies using isolated Complex I depleted of endogenous ND3

  • Activity measurements with specific inhibitors targeting different Complex I domains

  • Assembly analysis using antibodies against subunits from different Complex I modules

  • Stepwise reconstitution to identify at which point dysfunction occurs

  • Comparing phenotypes with known mutations in other Complex I subunits

This systematic approach localizes observed defects to either ND3 or other Complex I components.

What mass spectrometry approaches are most effective for studying ND3 protein-protein interactions within Complex I?

Specialized mass spectrometry approaches for ND3 interaction studies include:

  • Crosslinking Mass Spectrometry (XL-MS) using MS-cleavable crosslinkers to identify interaction interfaces

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS) to map protected regions indicative of protein-protein interactions

  • Native MS of intact subcomplexes to determine stable interaction modules containing ND3

  • Limited proteolysis coupled with MS to identify protected regions in assembled Complex I

  • Chemical labeling MS approaches to map solvent-accessible regions in assembled versus disassembled states

These techniques provide structural information about ND3's position and interactions within the Complex I architecture.

How can researchers use computational approaches to predict the effects of ND3 variants on Complex I structure and function?

Computational approaches provide valuable insights into ND3 variants:

  • Homology modeling based on resolved structures (e.g., mammalian Complex I) to predict B. napus ND3 structure

  • Molecular dynamics simulations to assess variant effects on protein stability and dynamics

  • Quantum mechanical/molecular mechanical (QM/MM) calculations to evaluate electron transfer properties

  • Evolutionary coupling analysis to identify co-evolving residues indicating functional relationships

  • Machine learning approaches integrating multiple parameters to predict variant pathogenicity

These in silico approaches guide experimental design and help interpret experimental outcomes of ND3 variant studies.

How might understanding ND3 function contribute to improving stress tolerance in Brassica napus?

Understanding ND3 function has practical applications for crop improvement:

  • Identification of ND3 variants associated with improved respiratory efficiency under stress conditions

  • Development of molecular markers for ND3 alleles conferring enhanced energy metabolism

  • Engineering optimized ND3 variants for improved photosynthetic efficiency via better energy balance

  • Understanding mitochondrial-nuclear interactions that depend on ND3 function under stress

  • Characterizing the role of ND3 in ROS management during abiotic stress responses

This knowledge bridges fundamental research with applied crop improvement strategies for stress tolerance.

What emerging technologies will likely advance our understanding of ND3 function in the coming years?

Emerging technologies promising for ND3 research include:

  • Cryo-electron tomography for studying ND3 in its native membrane environment

  • Single-molecule FRET to observe real-time conformational changes during catalysis

  • Mitochondria-targeted genome editing tools to modify ND3 in vivo

  • Organelle-specific proteomics to capture dynamic changes in ND3 interaction networks

  • Long-read sequencing technologies to better characterize mitochondrial genome variations affecting ND3

These technologies will provide unprecedented insights into ND3 function at molecular, cellular, and organismal levels.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.