Recombinant Brassica napus Oleosin-B4 (OlnB4)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
OlnB4; STA; 41-9; Oleosin-B4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
113-377
Protein Length
Full Length of Mature Protein
Species
Brassica napus (Rape)
Target Names
OlnB4
Target Protein Sequence
LGIPESIKPSNIIPESIKPSNIIPEGIKPSNIKDKIKDTIGKVKNKIKAKKEEKSKGKSE
DSSKGKGKSKGEDTTTDDDTTTDEDKHGSGAKHGKGESKHGKGESTHGKGGKHGSEGKHG
SGGSSMGGGKHGSGGKHETGGKHGSGGKHESGGSPMGGGKHGSEGKHGSGGASMGGGKHG
SGGKHESGGSAMGGGKHGSGGKHGSEGKHGGEGSSMGKNSLSKKKKEFHYRGQAMDASST
SESSDGSSDGSSSDGSSHGSGGKHI
Uniprot No.
Target Background
Function
Many major pollen coat proteins originate from the endoproteolytic cleavage of oleosin-like proteins.
Database Links
KEGG: bna:106419230
UniGene: Bna.2105
Protein Families
Oleosin family
Subcellular Location
Lipid droplet. Membrane; Multi-pass membrane protein.
Tissue Specificity
The full-length protein is found in the tapetal lipid bodies of immature anthers, the proteolytically cleaved C-terminal product is found on the coats of pollen grains. No expression is detected in other flower organs, siliques or seedlings.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
