Recombinant Brassica napus Oleosin Bn-V

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Brassica napus Oleosin Bn-V

Recombinant Brassica napus Oleosin Bn-V is a protein derived from the oilseed rape plant, Brassica napus. Oleosins are structural proteins found in plant oil bodies, which are organelles responsible for storing lipids. These proteins play a crucial role in maintaining the stability and structure of oil bodies by embedding themselves in the phospholipid monolayer surrounding the oil droplet, preventing coalescence and ensuring the proper distribution of lipids within the cell .

Characteristics of Recombinant Brassica napus Oleosin Bn-V

The recombinant full-length Brassica napus Oleosin Bn-V protein is expressed in Escherichia coli and is His-tagged for easy purification. It consists of 183 amino acids and is available in a lyophilized powder form. The protein's purity is greater than 90% as determined by SDS-PAGE, making it suitable for various biochemical applications .

Applications and Research Findings

Recombinant Brassica napus Oleosin Bn-V is primarily used in research related to lipid metabolism and oil body formation. Oleosins like Bn-V are crucial for understanding how plants store and mobilize lipids, which is important for improving oilseed crops like Brassica napus.

  • Lipid Metabolism: Oleosins are integral to the structure and function of oil bodies, influencing lipid storage and mobilization. Research on oleosins can help in enhancing oil content and quality in crops .

  • Biotechnological Applications: The recombinant expression of oleosins allows for the study of their role in lipid body formation and stability, which can be applied in biotechnology to improve oil production and storage in various plant species .

Biosynthesis and Targeting of Oleosin Proteins

Oleosin proteins, including those from Brassica napus, are synthesized in the endoplasmic reticulum and targeted to oil bodies. The biosynthesis and targeting of oleosin-like proteins in Brassica napus involve complex processes that include post-translational modifications and specific localization within plant cells .

Biosynthesis Process:

  1. Synthesis: Oleosins are synthesized in the endoplasmic reticulum.

  2. Targeting: They are targeted to oil bodies where they stabilize lipid droplets.

  3. Modification: Some oleosin-like proteins undergo proteolytic cleavage, which affects their function and localization .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
Oleosin Bn-V; BnV; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Brassica napus (Rape)
Target Protein Sequence
PARTHHDITTRDQYPLISRDRDQYGMIGRDQYNMSGQNYSKSRQIAKATTAVTAGDSLLV LSSLTLVGTVIALIVATPLLVIFSPILVPALITVALLITGFLSSGAFGIAAITVFSWIYK YATGEHPQGSDKLDSARMKLGSKAQDMKDRAYYYGQQHTGEEHDRDRDHRTDRDRTRGTQ HTT
Uniprot No.

Target Background

Function
This protein may play a structural role in stabilizing lipid bodies during seed desiccation, preventing oil coalescence. It likely interacts with both lipid and phospholipid components of lipid bodies. It may also provide recognition signals for specific lipase anchoring during lipolysis in seedling growth.
Database Links

UniGene: Bna.2121

Protein Families
Oleosin family
Subcellular Location
Lipid droplet. Membrane; Multi-pass membrane protein. Note=Surface of oil bodies. Oleosins exist at a monolayer lipid/water interface.

Q&A

What is Brassica napus Oleosin Bn-V and what is its biological function?

Brassica napus Oleosin Bn-V (also known as BnV) is a seed-specific protein expressed at high levels during the latter stages of embryo development in rapeseed (Brassica napus) . Oleosins are structural proteins that stabilize oil bodies—specialized organelles that store triacylglycerols in plant seeds. These proteins prevent oil bodies from coalescing during seed desiccation by forming a stable interface between the hydrophobic lipid core and the aqueous cytosol. The full-length protein consists of 183 amino acids and contains characteristic hydrophobic domains that enable its association with oil bodies . Functionally, Oleosin Bn-V contributes to seed viability by maintaining oil body integrity throughout seed development, desiccation, and germination when stored lipids are mobilized as an energy source.

How is the expression of Oleosin Bn-V regulated in plants?

Oleosin Bn-V gene expression is tightly regulated in a tissue-specific and temporally controlled manner. Studies using an 872 bp promoter fragment of the B. napus oleosin gene fused to β-glucuronidase (GUS) in transgenic tobacco plants have revealed several key aspects of its regulation . The gene is expressed at high levels exclusively in seeds, particularly in embryo and endosperm tissues, and is regulated throughout seed development. This tissue-specific and temporal regulation is coordinated primarily at the transcriptional level. Importantly, oleosin mRNA has been shown to be abscisic acid (ABA) inducible, with an ABA-response element in the oleosin promoter bound by a protein factor in a sequence-specific manner . Sequence analysis of the oleosin promoter has identified several other putative cis-acting sequences that may direct gene expression. One particularly interesting finding is that the oleosin gene promoter directs transcription in both directions, making it the first reported bidirectional nuclear gene promoter in plants .

What expression systems are effective for recombinant production of Oleosin Bn-V?

Escherichia coli represents the most commonly used expression system for recombinant production of Oleosin Bn-V. The BL21(DE3) strain is particularly effective due to its reduced protease activity and efficient T7 RNA polymerase expression . Fusion tags significantly enhance expression success, with His-tags and Maltose Binding Protein (MBP) being the most frequently employed options to improve solubility and facilitate purification . Optimized expression typically involves induction with IPTG (approximately 0.4 mM) when cultures reach OD600 of 0.6-1.0, with induction temperatures of 25-37°C and induction periods of 3-4 hours . Although E. coli is the predominant system, alternative expression platforms might include yeast systems, which provide a eukaryotic environment with posttranslational modification capabilities, or plant-based expression systems that more closely replicate the native environment for proper folding and potential lipid interactions.

What are the optimal storage conditions for maintaining recombinant Oleosin Bn-V stability?

Optimal storage conditions for recombinant Oleosin Bn-V are critical for maintaining long-term stability and activity. The protein is typically stored in a Tris-based buffer at pH 7.4-8.0, often supplemented with 50% glycerol to prevent aggregation and enhance stability . For long-term storage, temperatures of -20°C to -80°C are recommended, while working aliquots may be kept at 4°C for up to one week . Repeated freeze-thaw cycles should be avoided as they can lead to protein denaturation and aggregation. For lyophilized preparations, reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL is recommended prior to use . Addition of stabilizing agents such as trehalose (6%) has been shown to enhance protein stability during storage . When working with the protein, centrifugation prior to opening the vial is advised to bring the contents to the bottom, especially after thawing frozen samples.

What challenges exist in expressing functional Oleosin Bn-V in bacterial systems?

Expressing functional Oleosin Bn-V in bacterial systems presents several significant challenges related to its structural characteristics and native environment. The most prominent challenge involves protein folding and solubility issues stemming from Oleosin's large hydrophobic domain, which is designed to interact with lipids but tends to cause aggregation in aqueous environments . This frequently leads to inclusion body formation, significantly reducing soluble protein yield. Another critical challenge is the formation of protein complexes, as evidence suggests that oleosins form dimers and higher-order multimers that may affect purification efficiency—a phenomenon observed when MBP-tagged proteins failed to effectively bind to amylose resin . Bacterial expression systems also lack the machinery for plant-specific post-translational modifications that might be crucial for proper folding and function. Additionally, as oleosins are naturally membrane-associated proteins, they may interact nonspecifically with bacterial membranes, complicating extraction and purification procedures. Researchers have addressed these challenges through solubility-enhancing fusion tags, optimized expression conditions (particularly lower temperatures), and specialized extraction procedures.

How does the bidirectional promoter of Oleosin Bn-V function, and what are its research implications?

The bidirectional promoter of Oleosin Bn-V represents a fascinating regulatory mechanism with significant research implications. This promoter directs transcription in both directions, with the forward direction driving expression of the oleosin gene and the reverse direction expressing a large open reading frame (ORF2) that encodes a polypeptide similar to the ethylene-induced E4 gene of tomato . An 872 bp promoter fragment contains regulatory elements for oleosin gene expression, and PCR-generated DNA probes containing the ORF2 sequence hybridize with a 1.4 kb transcript in various tissues, including leaves and germinated seed cotyledons . This bidirectional arrangement represents the first reported bidirectional nuclear gene promoter in plants, providing an important model system for studying complex transcriptional regulation. The discovery has profound implications for understanding gene organization and evolution in plants, suggesting potential coordinate regulation of two genes with possibly related functions. From a biotechnological perspective, this bidirectional promoter could be exploited for simultaneous expression of two genes in transgenic plants, offering an efficient approach for metabolic engineering applications.

What techniques are most effective for analyzing protein-protein interactions involving Oleosin Bn-V?

Analyzing protein-protein interactions involving Oleosin Bn-V requires specialized techniques that accommodate its hydrophobic nature and tendency to form multimeric complexes. Chemical crosslinking combined with mass spectrometry represents a powerful approach, capable of capturing both stable and transient interactions while identifying specific interaction interfaces. Research has shown that recombinant DGAT2, another oil body-associated protein, forms dimers and higher-ordered multimers similar to Oleosin Bn-V from Brassica napus, indicating potential methodological parallels . Size exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) provides valuable information about oligomeric states under native conditions, with previous studies showing that similar proteins can elute at approximately eight times their predicted monomer size . Co-immunoprecipitation using specific antibodies can identify interaction partners in cellular extracts, while yeast two-hybrid systems—particularly split-ubiquitin systems designed for membrane proteins—can detect direct binary interactions. For structural characterization of complexes, single-particle cryo-electron microscopy offers high-resolution insights into larger assemblies, complemented by hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction surfaces with high precision.

How can recombinant Oleosin Bn-V be effectively used to study oil body formation?

Recombinant Oleosin Bn-V provides a powerful tool for studying oil body formation through several complementary approaches. In vitro reconstitution systems represent the most direct method, where purified recombinant Oleosin is combined with triacylglycerols and phospholipids under controlled conditions to form artificial oil bodies. This system allows researchers to systematically investigate the effects of protein concentration, lipid composition, and buffer conditions on oil body size, stability, and morphology. Mutagenesis approaches provide critical insights into structure-function relationships, with targeted modifications of the hydrophobic domain, particularly the proline knot motif, revealing key determinants of oil body association. Microscopy techniques including transmission electron microscopy (TEM) and confocal microscopy with fluorescently-tagged Oleosin Bn-V enable direct visualization of protein localization and oil body dynamics. For studying the molecular mechanisms of oil body formation, expression systems that produce recombinant Oleosin with appropriate posttranslational modifications (such as plant or yeast systems) offer advantages over bacterial expression, particularly when coupled with subsequent purification and characterization approaches .

What are the optimal conditions for expressing recombinant Oleosin Bn-V in E. coli?

Optimized conditions for expressing recombinant Oleosin Bn-V in E. coli systems have been systematically established through extensive research. The BL21(DE3) strain has proven most effective due to its reduced protease activity and efficient T7 RNA polymerase expression system . Expression vectors containing strong inducible promoters (T7, tac) coupled with appropriate fusion tags represent the foundation of successful expression strategies. The inclusion of fusion partners—particularly MBP (maltose-binding protein) and His-tags—significantly enhances solubility and facilitates subsequent purification . Growth conditions should include LB medium with appropriate antibiotic selection, with cultures grown to mid-log phase (OD600 0.6-1.0) prior to induction. Optimal induction parameters involve 0.4 mM IPTG at temperatures between 25-37°C for 3-4 hours, with lower temperatures generally favoring proper folding and increased solubility . Cell lysis should be performed by sonication in buffer containing 20 mM Tris–HCl (pH 7.4), 200-300 mM NaCl, 10 mM β-mercaptoethanol, and protease inhibitors (PMSF at 0.2-1 mM and protease inhibitor cocktail at 1:100-1:500 dilution) .

How can researchers effectively analyze the oligomeric state of Oleosin Bn-V?

Analyzing the oligomeric state of Oleosin Bn-V requires a multi-technique approach to comprehensively characterize its self-association properties. Size exclusion chromatography (SEC) provides the primary method for separating different oligomeric forms based on hydrodynamic radius, with previous studies on similar proteins showing elution at approximately eight times the predicted monomer size . This technique is most informative when coupled with multi-angle light scattering (SEC-MALS) for absolute molecular weight determination. SDS-PAGE analysis under various conditions (with and without reducing agents, at different temperatures) has revealed that dimers of recombinant DGAT2 proteins persist even under otherwise strong denaturing conditions, suggesting similar behavior might be observed with Oleosin Bn-V . Chemical crosslinking with bifunctional reagents (e.g., DSS, BS3) followed by mass spectrometry analysis can identify specific interaction interfaces, while analytical ultracentrifugation provides thermodynamic parameters of self-association. Research has demonstrated that protein bands with twice the size of monomer proteins are consistently detected by immunoblotting and confirmed by mass spectrometry, indicating strong evidence for dimer formation as a fundamental property of these proteins .

What techniques are most effective for studying Oleosin Bn-V interactions with lipids?

Studying Oleosin Bn-V interactions with lipids requires specialized techniques that capture the dynamics of protein-lipid interactions in environments mimicking the native oil body structure. Reconstitution systems represent the foundation of such studies, with proteoliposomes, nanodiscs, and artificial oil bodies providing controlled environments for systematic investigation. Differential scanning calorimetry (DSC) and isothermal titration calorimetry (ITC) deliver valuable thermodynamic parameters of protein-lipid interactions, quantifying binding affinity, stoichiometry, and energetics. Spectroscopic techniques including circular dichroism (CD) and Fourier-transform infrared spectroscopy (FTIR) detect structural changes upon lipid binding, while fluorescence approaches using either intrinsic tryptophan fluorescence or labeled lipids can monitor binding dynamics in real-time. For direct visualization, cryo-electron microscopy provides structural insights into protein-lipid complexes at near-atomic resolution. Lipid binding assays, including lipid overlay assays and liposome flotation techniques, offer functional readouts of binding specificity and strength. When designing such experiments, researchers should carefully consider lipid composition (including plant phospholipids and triacylglycerols), protein:lipid ratios, buffer conditions, and appropriate controls to distinguish specific from non-specific interactions.

What purification challenges are specific to Oleosin Bn-V and how can they be addressed?

Purification of recombinant Oleosin Bn-V presents several distinct challenges stemming from its hydrophobic nature and tendency to form multimeric complexes. A primary challenge involves incomplete binding to affinity resins, as demonstrated by studies showing that MBP-tagged proteins did not effectively bind to amylose resin and were recovered primarily in flow-through fractions . This issue likely results from protein folding that masks the affinity tag or from the formation of large protein complexes that restrict access to the affinity resin. Another significant challenge is the persistence of dimers and multimers even under denaturing conditions, complicating size-based separations . Additionally, extraction from inclusion bodies often requires harsh solubilization conditions that may affect protein structure and function. Researchers can address these challenges through several strategies: using dual tagging systems (such as MBP-DGAT2-His) to provide multiple purification options, optimizing buffer conditions with detergents or lipids to maintain solubility, employing batch purification rather than column approaches for improved binding, and implementing sequential purification strategies combining affinity chromatography with size exclusion and ion exchange methods .

How can researchers evaluate the functional activity of purified recombinant Oleosin Bn-V?

Evaluating the functional activity of purified recombinant Oleosin Bn-V requires assays that reflect its native role in oil body stabilization and membrane association. The primary functional assay involves reconstitution into artificial oil bodies, where purified Oleosin is mixed with triacylglycerols and phospholipids to form stable structures resembling native oil bodies. Successful reconstitution can be verified through multiple complementary approaches: microscopy techniques (both light and electron) to assess oil body size, number, and morphology; density gradient centrifugation to confirm proper association with the oil fraction; and stability assays measuring resistance to coalescence under various conditions (temperature, pH, ionic strength). Biophysical approaches provide additional functional insights, with circular dichroism spectroscopy monitoring proper secondary structure formation, particularly the α-helical regions critical for lipid interaction. Fluorescence anisotropy using labeled lipids can measure direct binding interactions and kinetics, while lipid monolayer insertion assays quantify the protein's ability to penetrate lipid interfaces. For more sophisticated functional analysis, researchers can employ site-directed mutagenesis of key residues (particularly in the hydrophobic domain and proline knot motif) followed by comparative functional assessment to identify critical structural determinants of Oleosin activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.