Recombinant Brassica napus Oleosin S1-2 (S1)

Shipped with Ice Packs
In Stock
Cat. No.
BT2493406
Source
in vitro E.coli expression system
Synonyms
S1; Oleosin S1-2
Quick Inquiry

Description

Biological Role and Functional Insights

Role in Oil Body Stability
Oleosin S1-2 anchors oil bodies by embedding its hydrophobic domain into the lipid monolayer, preventing coalescence during seed desiccation . In B. napus, oleosins constitute 84% of oil body proteins, with S1-2 being a major isoform .

Emulsification Capacity
The amphipathic structure enables S1-2 to act as a natural emulsifier, a property leveraged in food and pharmaceutical industries .

Research Findings on Genetic and Functional Impact

Gene Expression and Oil Content
Overexpression of oleosin genes (including homologs of S1-2) in Arabidopsis increased:

  • Seed oil content by up to 13.3% .

  • Linoleic acid levels while reducing palmitic acid .

  • Oil body size, correlating with higher lipid yields .

Key Genes Linked to Oil Accumulation

Gene NameChromosomeAssociation with Oil ContentExpression Pattern
BnOLEO1-C01C01Strong regional associationHigh in HOC lines
BnOLEO7-A03A03QTL overlapUpregulated at 45 DAP
BnOLEO3-C09C09Elevated in HOC accessionsPeak at 35 DAP
HOC = High-oil-content; DAP = Days after pollination .

Industrial and Agricultural Applications

Biotechnological Uses

  • Protein Purification: Recombinant S1-2 is used in ELISA kits for rapid detection assays .

  • Oil Extraction Optimization: Enhancing oleosin levels improves oil yield efficiency in rapeseed processing .

Agricultural Breeding

  • Haplotype analysis identified BnOLEO1-C01 and BnOLEO7-A03 as markers for high-oil cultivars, enabling marker-assisted selection .

Challenges and Future Directions

  • Stability Issues: Repeated freeze-thaw cycles degrade recombinant S1-2, necessitating optimized storage .

  • Functional Redundancy: The B. napus genome contains 48–53 oleosin genes, complicating isoform-specific studies .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
S1; Oleosin S1-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-193
Protein Length
Full Length of Mature Protein
Species
Brassica napus (Rape)
Target Names
S1
Target Protein Sequence
ADVRTHAHQVQVHPLRQHEGGIKVVYPQSGPSSTQVLAVVAGVPVGGTLLTLAGLTLAVS VIGLILAFPLFLIFSPVIVPAAFVIGLAMTGFMASGAIGLTGLSSMSWVLNHIRRVRERI PDELDEAKQRLADMAEYAGQRTKDAGQTIEDKAHDVRESKTYDVRDRDTKGHTASGGDRD TKTTREVRVATT
Uniprot No.
C3S7F0

Target Background

Function
This protein may play a structural role in stabilizing lipid bodies during seed desiccation by preventing oil coalescence. It likely interacts with both lipid and phospholipid components of lipid bodies. It may also provide recognition signals for specific lipase anchoring during lipolysis in seedling growth.
Database Links

UniGene: Bna.2633

Protein Families
Oleosin family
Subcellular Location
Lipid droplet. Membrane; Multi-pass membrane protein. Note=Surface of oil bodies. Oleosins exist at a monolayer lipid/water interface.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.