Recombinant Brassica napus Oleosin S2-2 (S2)

Shipped with Ice Packs
In Stock

Description

Composition and Structure

Oleosins like S2-2 are amphipathic proteins, meaning they have both hydrophobic and hydrophilic regions . They contain a long, central hydrophobic domain that is highly conserved, as well as two terminal hydrophilic domains, giving them emulsifying properties .

Function and Significance

Oleosins are the most important structural proteins of oil bodies (OBs) . They maintain OBs as small, individual units and prevent them from coalescing during seed desiccation . Adjusting oleosin protein levels can prevent the fusion of oil bodies and maintain oil body size during seed development .

Oleosin Genes in B. napus

Researchers have identified numerous oleosin genes in B. napus . These genes are divided into four lineages: T, U, SH, and SL . The expression levels of oleosin genes in different lineages vary among different tissues .

Expression Analysis and Oil Content

Sixteen oleosins belonging to the SH and SL lineages are expressed . BnOLEO3-C09, BnOLEO4-A02, BnOLEO4-A09, BnOLEO2-C04, BnOLEO1-C01, and BnOLEO7-A03 showed higher expression in high-oil-content accessions compared to low-oil-content accessions at 25, 35, and 45 days after pollination in two different environments .

Relationship with Oil Body Morphology

The morphology of OBs is correlated with seed oil content and fatty acid compositions, in which OB-membrane proteins might play important roles . The diameter of an OB typically ranges from 0.5 to 2.5 μm in B. napus . Low accumulation of oleosins can result in the formation of unusually large OBs in low oil content materials, showing a high correlation with low oil content in B. napus .

Impact on Seed Oil Production

Overexpression of the BnGRF2a gene, a GRF2-like gene from Brassica napus, in transgenic Arabidopsis resulted in an increase in seed oil production of over 50% . Overexpression of oleosin genes in A. thaliana has a weak effect on seed oil content but can increase the linoleic acid content and decrease the peanut acid content compared to wild type levels .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
S2; Oleosin S2-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-188
Protein Length
Full Length of Mature Protein
Species
Brassica napus (Rape)
Target Names
S2
Target Protein Sequence
ATVERRVQVDPTDKRIHLQPQYEGDVGYGYGYGGRADYKSSGPSSNQIVALIVGVPVGGS LLALAGLTLAGSVIGLMLSVPLFLLFSPVIVPAAITIGLAVTAILASGLFGLTGLSSVSW VLNYLRGTSDTVPEQLDYAKRRMADAVGYAGQKGKEMGQYVQDKAHEAHDTSLTTETTEP GKTRRHT
Uniprot No.

Target Background

Function
Oleosin S2-2 may play a structural role in stabilizing lipid bodies during seed desiccation by preventing oil coalescence. It likely interacts with both lipid and phospholipid components of lipid bodies. It may also provide recognition signals for specific lipase attachment during lipolysis in seedling growth.
Database Links

KEGG: bna:106428814

UniGene: Bna.2110

Protein Families
Oleosin family
Subcellular Location
Lipid droplet. Membrane; Multi-pass membrane protein. Note=Surface of oil bodies. Oleosins exist at a monolayer lipid/water interface.

Q&A

What is the genomic and structural context of Oleosin S2-2 within the B. napus oleosin family?

Oleosin S2-2 belongs to the extensive oleosin gene family in Brassica napus. A genome-wide analysis has identified 53 BnOLEO (B. napus oleosin) genes, which can be classified into four distinct lineages: T, SL, SH, and U lineages. The SL and SH lineages, which likely include Oleosin S2-2, contain genes particularly associated with seed development and oil accumulation .

The structural organization of oleosins typically includes a central hydrophobic domain flanked by amphipathic N- and C-terminal domains. This structure enables them to stabilize oil bodies by preventing coalescence during seed desiccation and germination. Phylogenetic analysis indicates evolutionary relationships between different oleosin family members, providing context for understanding the specific role of S2-2 .

How does Oleosin S2-2 expression correlate with seed oil content in B. napus?

RNA-seq analysis of high-oil-content (HOC) and low-oil-content (LOC) B. napus accessions has revealed that 16 oleosin genes belonging to the SL and SH lineages show significant expression during seed development. Among these, several oleosin genes (including BnOLEO3-C09, BnOLEO4-A02, BnOLEO4-A09, BnOLEO2-C04, BnOLEO1-C01, and BnOLEO7-A03) demonstrate consistently higher expression in HOC accessions compared to LOC accessions across multiple developmental timepoints (25, 35, and 45 days after pollination) and environmental conditions .

The expression patterns suggest that specific oleosin genes, potentially including S2-2, contribute significantly to oil accumulation in developing seeds. This relationship has been validated through both RNA-seq and quantitative real-time PCR methodologies, confirming the accuracy of the expression analysis .

What regulatory elements control Oleosin S2-2 expression in B. napus?

Analysis of cis-acting elements in the promoter regions of BnOLEO genes has identified several key regulatory motifs that likely influence oleosin expression. These include:

Element TypeSpecific ElementsFunctionAverage Frequency
Light-responsiveG-box, Box 4, GT1-motifLight regulation3.50, 2.67, 2.10 per promoter
Hormone-responsiveABREAbscisic acid response212 elements in 52 BnOLEO genes
Stress-responsiveARE elementsAnaerobic induction3.18 per promoter
Phytohormone-responsiveCGTCA- and TGACG-motifsMethyl jasmonate response198 elements across genes

These regulatory elements suggest that oleosin expression is influenced by light conditions, hormone signaling, and environmental stresses, providing insight into the complex regulation of oil accumulation in B. napus seeds .

What expression systems are optimal for producing functional recombinant Oleosin S2-2?

Based on current research practices with oleosins, several expression systems can be employed for recombinant Oleosin S2-2 production, each with distinct advantages:

  • Bacterial expression (E. coli): This system allows for His-tagged recombinant oleosin production, as evidenced by commercially available His-tagged Oleosin-B2 from B. napus . Bacterial systems offer high yield and cost-effectiveness but may struggle with proper folding of the hydrophobic domains.

  • Plant-based expression systems: These provide a more native cellular environment for proper folding and potential post-translational modifications. The transformation protocol described for B. napus using Agrobacterium-mediated methods can be adapted for recombinant oleosin expression .

When selecting an expression system, researchers should consider downstream applications, particularly whether structural integrity or post-translational modifications are critical for the intended experiments.

What purification challenges are specific to recombinant oleosins and how can they be addressed methodologically?

Purification of recombinant oleosins presents several challenges due to their amphipathic nature, particularly the extended hydrophobic domain. These challenges include:

  • Solubility issues: The central hydrophobic domain tends to cause aggregation in aqueous buffers.

  • Maintaining native conformation: Non-denaturing extraction conditions are crucial for preserving the structural integrity and immunoreactive epitopes of oleosins.

  • Purification efficiency: Affinity tags, such as His-tags, can facilitate purification but may influence protein behavior .

Recommended methodological approaches:

  • Use non-denaturing extraction buffers to preserve native conformation

  • Consider selective solubilization with mild detergents

  • Employ affinity chromatography with His-tagged constructs

  • For allergenicity studies, maintain non-reducing conditions as these better preserve conformational epitopes recognized by IgE antibodies

How can researchers investigate the molecular interactions between Oleosin S2-2 and lipid bodies?

To study oleosin-lipid interactions, researchers can employ several complementary methodologies:

  • In vitro reconstitution: Mixing purified recombinant oleosin with phospholipids and triacylglycerols to form artificial oil bodies.

  • Mutational analysis: Creating targeted mutations in the hydrophobic domain to identify residues critical for lipid interaction.

  • Microscopy techniques: Utilizing electron microscopy or confocal imaging to visualize oleosin localization on oil bodies.

  • Regional association analysis: This approach, as applied to BnOLEO1-C01 and BnOLEO7-A03, revealed that natural variations in these gene regions correlated with phenotypic variations in oil content across 50 re-sequenced rapeseed accessions .

  • Co-expression network analysis: This methodology demonstrated that oleosin genes form a regulatory network with lipid metabolism genes, transcription factors, and lipid transport-related genes .

What experimental approaches can assess the impact of Oleosin S2-2 modification on oil body size and stability?

Several experimental designs can evaluate how alterations in Oleosin S2-2 affect oil body morphology and stability:

  • Suppression experiments: Research has shown that suppressing storage proteins (napin and cruciferin) leads to increased oleosin accumulation and reorganization of intracellular architecture in B. napus . Similar approaches could target Oleosin S2-2 specifically.

  • Transformation protocols: Utilizing Agrobacterium-mediated transformation with selection markers like phosphinothricin (described in search result ) allows for the generation of transgenic B. napus lines with modified oleosin expression.

  • Comparative proteomics: Analyzing oil body proteomes from wild-type and modified lines to assess changes in protein composition and abundance.

  • Microscopic analysis: Quantifying oil body size distribution, number, and morphology in developing seeds with altered Oleosin S2-2 expression.

How can regional association analysis be applied to identify natural variations in Oleosin S2-2 linked to enhanced oil content?

Regional association analysis represents a powerful approach for identifying functionally significant natural variations in oleosin genes:

  • Methodology overview: This technique involves:

    • Resequencing diverse B. napus accessions (50 accessions with 532,005 SNPs were used in previous studies)

    • Phenotyping for seed oil content

    • Identifying significant associations between genetic variants and phenotypic traits

  • Application to oleosins: Previous research demonstrated that BnOLEO1-C01-Hap1 and BnOLEO7-A03-Hap1 haplotypes corresponded to accessions with higher seed oil contents compared to other haplotype alleles . Similar methodology could be applied specifically to Oleosin S2-2.

  • Integration with expression data: Combining genomic variation data with expression analysis during seed development (25, 35, and 45 days after pollination) can provide comprehensive understanding of genotype-phenotype relationships .

  • Marker development: Identified variations can be developed into molecular markers for marker-assisted selection in breeding programs targeting enhanced oil content .

What approaches can determine the potential allergenicity of recombinant versus native Oleosin S2-2?

Research on mustard allergens provides methodological insights for investigating potential allergenicity of Oleosin S2-2:

  • Immunoblotting methodology: Using sera from sensitized individuals to assess IgE-binding patterns under both reducing and non-reducing conditions. Previous research demonstrated that some allergens (including oleosins identified as novel IgE-binding proteins) exhibited stronger reactivity under non-reducing conditions, indicating the importance of conformational epitopes .

  • Mass spectrometry identification: MS analysis of in-gel digested IgE-reactive bands can confirm the identity of potential allergenic proteins. This approach previously identified oleosin among novel allergens in mustard varieties .

  • Bioinformatic sequence comparison: Comparing amino acid sequences with known allergens can reveal homologies relevant for potential allergic cross-reactivity .

  • Extraction condition optimization: Non-denaturing protein extraction is crucial for allergenicity studies, as denaturing conditions may lead to failure in detecting important immunoreactive epitopes .

How does Oleosin S2-2 interact with other proteins in the oil body proteome?

Understanding protein-protein interactions involving Oleosin S2-2 can provide insights into the complex regulatory networks controlling oil accumulation:

  • Co-expression network analysis: This approach has revealed that oleosin genes are directly related to:

    • Lipid/fatty acid metabolism genes

    • Transcription factors

    • Lipid transport-related genes

    • Carbohydrate-related genes

    These relationships form a molecular network potentially regulating seed oil accumulation .

  • Protein-protein interaction studies: Techniques such as co-immunoprecipitation, yeast two-hybrid analysis, or proximity labeling can identify direct interaction partners.

  • Transcriptional regulation analysis: The presence of hormone-responsive elements (ABRE, CGTCA- and TGACG-motifs) and light-responsive elements (G-box, Box 4, GT1-motif) in oleosin promoters suggests complex transcriptional regulation networks that can be experimentally mapped .

What controls and validation methods are essential when working with recombinant Oleosin S2-2?

Robust experimental design for recombinant oleosin research requires several key controls and validation steps:

  • Expression validation: Confirmation of successful transformation can be performed using:

    • DNA gel blot analysis to select single-insert transformants

    • TaqMan assays to verify the presence of transgenic sequences

  • Protein expression verification: Western blotting with oleosin-specific antibodies or tag-specific antibodies for recombinant constructs.

  • Functional validation: Comparing native and recombinant oleosin behavior in:

    • Oil body association assays

    • Lipid binding capacity

    • Structural stability assessments

  • Experimental controls: Include wild-type lines alongside transgenic lines for accurate phenotypic comparison. In previous studies, transformed plants were paired with wild-type segregant (WTS) lines as controls .

What methodological considerations are critical for studying temporal expression patterns of Oleosin S2-2 during seed development?

To accurately characterize the temporal expression dynamics of Oleosin S2-2 during seed development:

  • Developmental staging: Collect samples at defined developmental stages, such as 25, 35, and 45 days after pollination (DAP), as used in previous oleosin expression studies .

  • RNA extraction and analysis methodology:

    • RNA-seq can provide comprehensive transcriptome profiles

    • qRT-PCR validation should be performed to confirm RNA-seq results, as demonstrated in previous studies where qRT-PCR results were consistent with RNA-seq data

  • Environmental considerations: Test expression patterns across different environmental conditions, as previous research examined oleosin expression in two different environments to ensure robustness of findings .

  • Comparative analysis: Include both high-oil-content (HOC) and low-oil-content (LOC) accessions to correlate expression patterns with phenotypic differences .

  • Data normalization: Normalize expression data (e.g., log10 FPKM as used in previous studies) for accurate comparisons across different samples and conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.