Recombinant Brassica napus Photosystem Q (B) protein

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

BnaPSQ-B belongs to the light-harvesting chlorophyll a/b-binding protein (LHCB) family, specifically associated with PSII. Structural analysis reveals it contains conserved chlorophyll-binding domains and transmembrane helices critical for its role in light capture and energy transfer .

Key Features:

  • Gene locus: BnaLHCB3 (homolog of AT1G29910 in Arabidopsis)

  • Molecular weight: ~25 kDa (predicted)

  • Subcellular localization: Thylakoid membrane

  • Post-translational modifications: Redox-sensitive cysteine residues identified, suggesting regulation via sulfenylation under stress

Functional Role in Photosynthesis

BnaPSQ-B facilitates the assembly and stability of the PSII–LHCII supercomplex. Its interaction with mitogen-activated protein kinase 1 (BnaMAPK1) enhances photosynthetic efficiency under shading stress by modulating antenna protein complexes .

Mechanistic Insights:

  • Electron transport: Mediates electron transfer from QA to QB in PSII.

  • Stress adaptation: Upregulated under low-light conditions to maintain carbon assimilation capacity .

  • Antioxidant role: Sulfenylation modifications under freezing stress improve redox homeostasis .

Expression Patterns and Regulation

Transcriptomic and proteomic analyses highlight tissue-specific and stress-responsive expression:

ConditionExpression LevelTissueReference
Shading stressUpregulated 2.5×Leaves
Freezing stressSulfenylation ↑Leaves
Normal lightBaselineAll photosynthetic tissues

Interaction Partners

BnaPSQ-B forms functional complexes with:

  • BnaMAPK1: Stabilizes PSII–LHCII supercomplex under low light .

  • Mg-chelatase subunits: Co-expressed with BnaA03g0054400ZS (H subunit), affecting chlorophyll biosynthesis .

  • Redox-sensitive enzymes: Interacts with thioredoxin-like proteins under oxidative stress .

Research Challenges and Future Directions

  • Structural resolution: Cryo-EM studies are needed to resolve its 3D conformation within PSII.

  • Field trials: Validate transgenic lines overexpressing BnaPSQ-B under real-world stress conditions.

  • Regulatory networks: Integrate omics data to map its role in broader photosynthetic and stress-response pathways .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
psbA; Photosystem II protein D1; PSII D1 protein; Photosystem II Q(B protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-344
Protein Length
Full Length of Mature Protein
Species
Brassica napus (Rape)
Target Names
psbA
Target Protein Sequence
TAILERRESESLWGRFCNWITSTENRLYIGWFGVLMIPTLLTATSVFIIAFIAAPPVDID GIREPVSGSLLYGNNIISGAIIPTSAAIGLHFYPIWEAASVDEWLYNGGPYELIVLHFLL GVACYMGREWELSFRLGMRPWIAVAYSAPVAAATAVFLIYPIGQGSFSDGMPLGISGTFN FMIVFQAEHNILMHPFHMLGVAGVFGGSLFSAMHGSLVTSSLIRETTENESANEGYRFGQ EEETYNIVAAHGYFGRLIFQYAGFNNSRSLHFFLAAWPVVGIWFTALGISTMAFNLNGFN FNQSVVDSQGRVINTWADIINRANLGMEVMHERNAHNFPLDLA
Uniprot No.

Target Background

Function

Photosystem II (PSII) is a light-driven water:plastoquinone oxidoreductase. It utilizes light energy to extract electrons from H₂O, generating O₂ and a proton gradient for subsequent ATP formation. PSII comprises a core antenna complex for photon capture and an electron transfer chain converting photonic excitation into charge separation. The D1/D2 (PsbA/PsbD) reaction center heterodimer binds P680, the primary electron donor of PSII, and several downstream electron acceptors.

Protein Families
Reaction center PufL/M/PsbA/D family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genetic basis of Photosystem Q (B) protein expression in Brassica napus?

The Photosystem Q (B) protein in B. napus is encoded by nuclear genes that produce components of the photosynthetic apparatus. Research indicates that PHOTOSYSTEM II SUBUNIT Q-2 transcripts show significant upregulation (25% increase) during enhanced photosynthetic conditions . The expression is regulated through complex genetic mechanisms involving both nuclear and plastid genomes.

Photosystem genes in B. napus are primarily transcribed by plastid-encoded polymerase (PEP), which is classified as a Class I transcription system inherited from cyanobacterial ancestors . The expression pattern follows diurnal rhythms and responds to light intensity, with regulatory elements in promoter regions controlling transcription rates. Quantitative PCR analysis using appropriate housekeeping genes such as β-Actin can effectively quantify relative transcript abundance using the ΔΔCt method .

How do chlorophyll content and photosynthetic rates correlate with Photosystem Q protein expression?

For quantification, pigment extraction using 80% acetone (20% v/v 0.2M Tris-HCl pH 8.0) allows measurement of chlorophyll content by spectrophotometry at 663 nm and 645 nm wavelengths . Photosynthetic rates can be measured using infrared gas analysis (IRGA) equipment with a standard protocol exposing leaves to 200 μmol/m²/s light intensity while feeding ambient air at 0.003 L/s . These physiological measurements provide functional validation of genetic and protein expression changes.

What experimental systems are optimal for studying recombinant Photosystem Q (B) protein function?

For functional studies of recombinant Photosystem Q (B) protein, several complementary systems yield robust results:

  • Chlorophyll-deficient mutants: Mutants like the yl1 (yellow leaf) B. napus line provide excellent contrast for complementation studies with recombinant proteins . These mutants show impaired chlorophyll biosynthesis throughout their growth period.

  • RNA interference or CRISPR-based knockdowns: These allow targeted reduction of native protein to assess recombinant protein function.

  • Chlorophyll fluorescence measurement systems: These provide non-destructive assessment of photosystem function in vivo, with parameters like maximum quantum yield (Fv/Fm) indicating photosystem II efficiency .

  • Heterologous expression systems: E. coli or yeast systems with appropriate modifications for membrane protein expression can produce recombinant protein for biochemical characterization.

The choice depends on research objectives, with mutant complementation being particularly informative for structure-function relationships.

How can genomic approaches identify regulatory elements controlling Photosystem Q (B) protein expression?

Genome-wide association studies (GWAS) have successfully identified quantitative trait nucleotides (QTNs) associated with photosynthetic efficiency in B. napus. A comprehensive approach requires:

  • Population selection: A diverse panel of at least 100 B. napus accessions representing different ecotypes should be phenotyped for photosynthetic parameters .

  • High-density genotyping: The Brassica 50K Illumina Infinium consortium SNP array provides sufficient resolution for initial mapping, with filtering criteria including missing rate ≤0.2, heterozygous rate ≤0.2, and minor allele frequency >0.05 .

  • Statistical analysis: Mixed linear models implemented in software like TASSEL5 effectively account for population structure and kinship relationships .

  • Candidate gene identification: Significant SNPs can be used to identify regulatory elements, with 3,129 potential candidate genes identified in previous studies of photosynthetic traits .

Integration with chromatin immunoprecipitation (ChIP) data can further reveal transcription factor binding sites in promoter regions of Photosystem Q genes, providing mechanistic insights into expression regulation.

What methods overcome challenges in recombinant Photosystem Q (B) protein purification and functional reconstitution?

Purification and reconstitution of membrane-integrated photosystem proteins present significant challenges. An optimized protocol includes:

  • Expression system selection: While E. coli systems offer high yield, they often lack proper post-translational modifications. Brassica cell suspension cultures may provide a more native environment for proper folding of recombinant Photosystem Q proteins.

  • Detergent optimization: A screening approach testing multiple detergents (DDM, OG, LDAO) at varying concentrations is essential for maintaining protein stability and function during extraction.

  • Affinity purification: A dual approach using both His-tag and specific antibody affinity columns significantly improves purity.

  • Functional reconstitution: Incorporation into liposomes with appropriate lipid composition (MGDG:DGDG:SQDG:PG at 20:30:15:35 ratio) better preserves native protein conformation and function.

  • Activity validation: Electron transport measurements using artificial electron acceptors can confirm functionality of reconstituted protein.

The critical success factor is maintaining the structural integrity of transmembrane domains during the purification process, which can be monitored using circular dichroism spectroscopy.

How can chlorophyll fluorescence techniques assess the functional impact of mutations in Photosystem Q (B) protein?

Chlorophyll fluorescence provides powerful insights into photosystem function. For Photosystem Q (B) protein analysis:

  • Pulse-amplitude modulation (PAM) fluorometry: This non-invasive technique can detect subtle changes in electron transport efficiency resulting from mutations .

  • Induction kinetics analysis: The fluorescence rise curve (OJIP transient) reflects electron transport through the QB binding site, with altered kinetics indicating functional changes in the Photosystem Q (B) protein .

  • Inhibitor studies: DCMU (3-(3,4-dichlorophenyl)-1,1-dimethylurea) specifically blocks electron transfer to QB, providing a control condition to compare with mutant phenotypes .

  • Fluorescence quenching analysis: Distinguishes between photochemical quenching (qP) related to electron transport and non-photochemical quenching (NPQ) related to heat dissipation .

When applying these techniques to Photosystem Q (B) protein variants, it's essential to standardize measurement conditions (light intensity, temperature, leaf age) to obtain reproducible results.

What RNA extraction and gene expression analysis protocols are most appropriate for studying Photosystem Q (B) protein transcription?

For reliable quantification of Photosystem Q (B) transcripts in B. napus:

  • RNA extraction: An optimized cetyltrimethylammonium bromide (CTAB) method yields high-quality RNA from photosynthetic tissues with minimal contamination by polyphenols and polysaccharides .

  • cDNA synthesis: Maxima First Strand cDNA synthesis kit or equivalent technologies provide consistent reverse transcription efficiency .

  • qPCR design: Specific primers targeting unique regions of the Photosystem Q (B) gene sequence should be validated with melt curve analysis to confirm specificity .

  • Reference gene selection: β-Actin serves as an appropriate reference gene, but validation with multiple reference genes (e.g., UBC9, PP2A) provides greater reliability .

  • Data analysis: The ΔΔCt method with appropriate statistical testing (One-way ANOVA, P < 0.05) accurately quantifies relative transcript abundance .

Table 1: Recommended PCR conditions for Photosystem Q (B) gene expression analysis

StepTemperatureDurationCycles
Initial denaturation95°C3 minutes1
Denaturation95°C30 seconds44
Annealing58°C30 seconds44
Extension72°C30 seconds44
Melt curve55°C to 95°C0.5°C increments1

What mapping strategies can identify genetic determinants of Photosystem Q (B) protein variation?

Several complementary mapping approaches have proven effective:

  • QTL-Seq analysis: This method combines bulk segregant analysis with whole-genome sequencing to identify genomic regions associated with photosynthetic traits .

  • Fine mapping: Construction of large F₂ populations (>5000 individuals) allows high-resolution mapping of candidate genes .

  • Penta-primer amplification refractory mutation system (PARMS): This SNP genotyping method based on fluorescence detection effectively identifies recombinant plants for fine mapping .

  • Marker development: SNP-based markers developed from candidate gene sequences can be used for marker-assisted selection in breeding programs .

The integration of these approaches has successfully identified genes like BnA03.Chd (encoding the H subunit of Mg-chelatase), demonstrating their applicability to photosystem components .

How should researchers address the polyploid complexity of B. napus when studying Photosystem Q (B) protein variants?

B. napus is an allotetraploid with a complex genome structure, requiring specialized approaches:

  • Homoeologous gene identification: Both A and C sub-genomes contain homoeologous copies of photosystem genes that must be distinguished in expression and functional analyses .

  • Sub-genome specific primers: Design primers targeting unique single nucleotide polymorphisms (SNPs) or insertions/deletions (InDels) to specifically amplify each homoeologue .

  • Pangenomic analysis: Single-reference genomes may miss important gene variants due to presence-absence variation (PAV); pangenomic approaches incorporating multiple B. napus lines provide more comprehensive gene coverage .

  • Copy number variation analysis: Quantify gene copy number using digital PCR or comparative genomic hybridization to account for potential gene duplications .

  • Homoeologous exchange consideration: Frequent homoeologous exchanges between sub-genomes during domestication may have affected Photosystem Q (B) gene variants .

The complete 'Express 617' and 'Darmor-bzh' B. napus genome assemblies provide reference resources for addressing these complexities .

What statistical approaches best address variability in photosynthetic measurements when analyzing Photosystem Q (B) protein effects?

Photosynthetic measurements inherently show biological variability requiring robust statistical approaches:

  • Experimental design considerations:

    • Minimum 10 biological replicates per treatment

    • Randomized complete block design to account for environmental gradients

    • Standardization of leaf position, age, and time of day for measurements

  • Statistical methods:

    • Mixed-effects models to account for both fixed (treatment) and random (plant, environment) factors

    • ANOVA with appropriate post-hoc tests (Tukey's HSD) for multiple comparisons

    • Non-parametric alternatives (e.g., Kruskal-Wallis) when normality assumptions are violated

  • Data transformation approaches:

    • Log transformation for physiological data showing proportional effects

    • Box-Cox transformations to address heteroscedasticity

  • Correlation analysis:

    • Pearson's or Spearman's correlation coefficients between photosynthetic parameters and protein expression levels

    • Principal component analysis to identify major sources of variation in multivariate datasets

How might CRISPR-Cas9 genome editing advance functional characterization of Photosystem Q (B) protein in B. napus?

CRISPR-Cas9 technology offers unprecedented precision for Photosystem Q (B) protein research:

  • Homoeologue-specific editing: Guide RNAs targeting unique sequences can modify specific homoeologues, allowing assessment of their relative contributions to photosynthetic function.

  • Domain-specific modifications: Precise edits in functional domains can create allelic series to elucidate structure-function relationships without complete gene knockout.

  • Promoter editing: Modifying regulatory regions can alter expression patterns temporally or spatially to assess developmental roles.

  • Tag insertion: In-frame insertion of epitope or fluorescent tags enables protein localization and interaction studies in native contexts.

  • Base editing approaches: Technologies like cytosine or adenine base editors allow introduction of specific amino acid changes without double-strand breaks, reducing potential off-target effects.

The polyploid nature of B. napus presents challenges but also opportunities to create genetic combinations impossible in diploid species, potentially revealing functional redundancy or specialization among homoeologues.

What interplay exists between reactive oxygen species (ROS) management and Photosystem Q (B) protein function in stress responses?

The relationship between ROS and Photosystem Q (B) protein reveals important stress adaptation mechanisms:

  • ROS production sites: Impaired electron transport through the QB site can increase ROS production at Photosystem II, potentially damaging the D1 protein.

  • Antioxidant enzyme coordination: Enhanced photosynthetic gene expression correlates with upregulation of ROS scavenging mechanisms, including COPPER/ZINC SUPEROXIDE DISMUTASE (26% increase) and COPPER CHAPERONE (75% increase) .

  • Signaling networks: ROS generated at Photosystem II may function as retrograde signals to coordinate nuclear gene expression with chloroplast function.

  • Adaptation mechanisms: Under stress conditions, the QB site may become more oxidized, triggering protective non-photochemical quenching mechanisms .

  • Varietal differences: Different B. napus cultivars show varying capacities to maintain Photosystem Q (B) protein function under oxidative stress, providing genetic resources for improvement.

Understanding these relationships could guide development of B. napus varieties with enhanced stress tolerance without sacrificing photosynthetic efficiency.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.