Recombinant Brassica napus Squalene monooxygenase 1,2 (SQP1,2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SQP1,2; Squalene monooxygenase 1,2; Squalene epoxidase 1,2; SE 1,2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-518
Protein Length
full length protein
Species
Brassica napus (Rape)
Target Names
SQP1
Target Protein Sequence
MDMAFVEVCLRMLLVFVLSWTIFHVNNRKKKKATKLADLATEERKEGGPDVIIVGAGVGG SALAYALAKDGRRVHVIERDMREPVRMMGEFMQPGGRLMLSKLGLQDCLEEIDAQKSTGI RLFKDGKETVACFPVDTNFPYEPSGRFFHNGRFVQRLRQKASSLPNVRLEEGTVRSLIEE KGVVKGVTYKNSSGEETTSFAPLTVVCDGCHSNLRRSLNDNNAEVTAYEIGYISRNCRLE QPDKLHLIMAKPSFAMLYQVSSTDVRCNFELLSKNLPSVSNGEMTSFVRNSIAPQVPLKL RKTFLKGLDEGSHIKITQAKRIPATLSRKKGVIVLGDAFNMRHPVIASGMMVLLSDILIL SRLLKPLGNLGDENKVSEVMKSFYALRKPMSATVNTLGNSFWQVLIASTDEAKEAMRQGC FDYLSSGGFRTSGLMALIGGMNPRPLSLFYHLFVISLSSIGQLLSPFPTPLRVWHSLRLL DLSLKMLVPHLKAEGIGQMLSPTNAAAYRKSYMAATVV
Uniprot No.

Target Background

Function

This enzyme catalyzes the stereospecific oxidation of squalene to (S)-2,3-epoxysqualene. It is considered a rate-limiting enzyme in steroid biosynthesis.

Database Links

KEGG: bna:106415877

UniGene: Bna.2190

Protein Families
Squalene monooxygenase family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Brassica napus Squalene monooxygenase 1,2 (SQP1,2) and what is its role in sterol biosynthesis?

Squalene monooxygenase (SQP), also known as squalene epoxidase (SQLE), is a critical enzyme in the sterol biosynthetic pathway that catalyzes the stereospecific conversion of squalene to 2,3(S)-oxidosqualene. This represents the first oxygenation step in sterol biosynthesis and is considered a key regulatory point in the pathway. In Brassica napus, multiple homologues of squalene monooxygenase exist, with SQP1,2 being one of these variants .

The enzyme requires FAD, NADPH-cytochrome P450 reductase, and NADPH as cofactors for its activity. Structurally, squalene monooxygenases typically contain one potential transmembrane domain and a FAD binding domain, indicating they function as flavoproteins . The reaction catalyzed by SQP1,2 is particularly significant because it represents the first committed step specifically toward sterol formation, distinguishing this metabolic branch from other isoprenoid pathways.

How does the structure of SQP1,2 compare to other squalene monooxygenase homologues in Brassica napus?

Based on comparative studies of squalene monooxygenase homologues, Brassica napus contains multiple variants of this enzyme. The SQP1,1 variant consists of 506 amino acids with specific structural elements including a transmembrane region and a FAD binding domain . While specific structural data for SQP1,2 is not directly presented in the available research, comparisons with other homologues provide valuable insights.

Sequence analysis of squalene monooxygenase homologues in Brassica napus and related species like Arabidopsis thaliana reveals interesting evolutionary characteristics. The comparison of cDNA and genomic sequences indicates that the 3' splice site of an intron in these genes has undergone junctional sliding, a phenomenon with significant evolutionary implications . This structural variation may contribute to functional differences between the various homologues, potentially affecting substrate specificity or regulatory properties.

What genomic and transcriptomic data exist for SQP1,2 in Brassica napus?

Transcriptomic analyses in Brassica napus have revealed expression patterns for sterol biosynthesis genes, including squalene monooxygenase homologues. Time-series transcriptomic analysis has shown that differentially expressed genes (DEGs) involved in sterol and lipid biosynthesis pathways are enriched during seed development . Additionally, regulatory networks between sterol-related DEGs and transcription factors have been established using coexpression analysis, providing insights into the transcriptional regulation of these genes .

While specific data for SQP1,2 is limited in the provided research, the methodology for analyzing expression patterns can be applied to this gene variant. By examining expression across different tissues and developmental stages, researchers can deduce the specific roles of SQP1,2 compared to other homologues. Quantitative PCR analysis comparing expression levels between different genotypes, as demonstrated with other sterol biosynthesis genes, can reveal genetic variations influencing SQP1,2 expression .

What are the optimal conditions for expressing and purifying recombinant Brassica napus SQP1,2?

Based on successful expression of similar proteins, recombinant Brassica napus SQP1,2 can be effectively expressed in E. coli expression systems with an N-terminal His-tag for purification purposes . When designing your expression system, consider the following protocol adaptations:

  • Vector Selection: Use expression vectors containing strong promoters (e.g., T7) and appropriate selection markers

  • Expression Host: BL21(DE3) or Rosetta strains of E. coli are recommended for membrane-associated proteins

  • Induction Conditions: Optimize IPTG concentration (typically 0.1-1.0 mM) and induction temperature (typically lowered to 16-25°C for membrane proteins)

  • Purification Strategy:

    • Include detergents in lysis buffers to solubilize the membrane-associated portions

    • Implement a two-step purification using immobilized metal affinity chromatography followed by size exclusion chromatography

    • Consider removing the transmembrane domain for improved solubility (as demonstrated with other SQS enzymes)

For storage, maintaining the purified protein in Tris/PBS-based buffer with approximately 6% trehalose at pH 8.0 has been shown to preserve activity. Addition of 5-50% glycerol and storage at -20°C/-80°C is recommended for long-term stability, with aliquoting to avoid repeated freeze-thaw cycles .

How can I assess the enzymatic activity of recombinant SQP1,2 in vitro?

To assess SQP1,2 enzymatic activity in vitro, the following methodological approach is recommended based on successful assays of related enzymes:

  • Substrate Preparation: Prepare squalene as the substrate, ensuring high purity to avoid interference

  • Reaction Buffer Components:

    • Include essential cofactors: FAD, NADPH, and NADPH-cytochrome P450 reductase

    • Optimize buffer composition (typically 100 mM potassium phosphate, pH 7.4)

    • Add appropriate detergents to maintain enzyme solubility

  • Assay Conditions:

    • Incubate at 30°C for 30-60 minutes

    • Include appropriate controls (heat-inactivated enzyme, no substrate, no cofactors)

  • Detection Methods:

    • HPLC analysis of the 2,3(S)-oxidosqualene product

    • LC-MS for more sensitive detection and confirmation of product identity

    • Radiometric assays using [14C]-labeled substrates for quantitative analysis

Activity comparison between different variants can be particularly informative. For example, research has shown significant differences in enzyme activity between different genotypes in Brassica napus, which correlates with variations in total sterol content . Similar comparative analysis can be performed for SQP1,2 to assess its specific catalytic efficiency.

What genetic variations of SQP1,2 exist in different Brassica napus genotypes and how do they affect enzyme function?

Genetic variation in sterol biosynthesis genes between Brassica napus genotypes has been documented, with significant implications for enzyme function and sterol content. For squalene monooxygenase homologues, the following analysis approach can identify and characterize genetic variations:

  • Sequence Analysis: Compare gDNA sequences across genotypes to identify SNPs in coding regions. Previous studies of related genes have identified missense mutations that potentially affect protein function .

  • Expression Variation: Significant differences in gene expression levels between different genotypes have been observed, as demonstrated with BnSQS1.C03 which showed varied expression levels between parental lines in a mapping population .

  • QTL Analysis: Integrating genetic variation data with quantitative trait loci (QTL) mapping can identify genomic regions associated with sterol content variation. In Brassica napus, QTL for total sterol and individual sterol components have been identified, providing a framework for similar analysis of SQP1,2 variants .

  • Protein Structure Impact: Missense mutations can be analyzed for their impact on protein structure and function using structural prediction tools like AlphaFold. This approach has been successfully used to compare structures of homologous proteins and predict functional implications .

The table below illustrates how genetic variations might be analyzed:

GenotypeSNP PositionNucleotide ChangeAmino Acid ChangePredicted Structural ImpactEnzyme Activity (relative)
Reference----1.0
Variant 1Exon 2, pos 245G→AAla82ThrMinor alteration in FAD binding domain0.85
Variant 2Exon 5, pos 789C→TPro263SerPotential disruption of active site0.62
Variant 3Exon 7, pos 1056T→CSilent mutationNone1.02

How does SQP1,2 expression respond to different abiotic stresses in Brassica napus?

Abiotic stress responses in Brassica napus involve complex transcriptional regulation, affecting sterol biosynthesis genes. Multi-omics studies have revealed that macronutrient deficiencies (N, P, and K) significantly impact gene expression patterns, with more pronounced effects on roots compared to shoots . While specific data for SQP1,2 is not directly presented in the available research, the methodological approach for studying stress responses can be applied:

  • Stress Treatment Design:

    • Apply controlled abiotic stresses (drought, salt, temperature extremes, nutrient deficiencies)

    • Include appropriate time course sampling (early, middle, and late response phases)

    • Analyze both roots and shoots separately to capture tissue-specific responses

  • Expression Analysis Methods:

    • RT-qPCR for targeted expression analysis

    • RNA-seq for genome-wide transcriptional profiling

    • Western blotting for protein-level confirmation

  • Integrated Analysis:

    • Correlate expression changes with physiological parameters

    • Identify transcription factors regulating SQP1,2 expression under stress

    • Examine post-transcriptional regulation through miRNA and circRNA analyses

Research has shown that oxidative stress components significantly impact sterol biosynthesis, with reactive oxygen species quantities being significantly increased by macronutrient deficiencies . This suggests that SQP1,2 expression may be modulated as part of the plant's stress response mechanism, potentially affecting sterol composition under stress conditions.

What methods are available for manipulating SQP1,2 expression to study its function in Brassica napus?

Multiple complementary approaches can be employed to manipulate SQP1,2 expression for functional studies:

  • Overexpression Studies:

    • Construct vectors containing SQP1,2 under control of constitutive promoters (e.g., CaMV 35S) or tissue-specific promoters

    • Transform Brassica napus or model plants like Arabidopsis

    • Quantify the impact on sterol content and composition

    • Assess phenotypic changes in growth, development, and stress responses

    This approach has been successfully demonstrated with BnSQS1.C03, where overexpression in Arabidopsis increased total sterol content by 3.8% .

  • Gene Silencing/Knockout Approaches:

    • CRISPR/Cas9-mediated gene editing for precise knockout

    • RNAi-based silencing for partial knockdown

    • Virus-induced gene silencing for temporary suppression

  • Promoter Analysis:

    • Identify regulatory elements in the SQP1,2 promoter region

    • Perform deletion analysis to determine functional regions

    • Construct promoter-reporter fusions to study expression patterns

    Previous studies have identified numerous motifs in sterol biosynthesis gene promoters in Brassica species, which could inform similar analysis of SQP1,2 .

  • Subcellular Localization:

    • Create GFP fusion proteins to visualize subcellular localization

    • Confirm endoplasmic reticulum localization, as observed with other sterol biosynthesis enzymes

How can I integrate SQP1,2 research into broader sterol metabolism studies in Brassica napus?

Integrating SQP1,2 research into broader sterol metabolism studies requires a multi-faceted approach:

  • Pathway Integration Analysis:

    • Map SQP1,2 function within the complete sterol biosynthetic pathway

    • Analyze co-expression patterns with other pathway genes

    • Identify rate-limiting steps and regulatory nodes

  • Multi-omics Integration:

    • Combine transcriptomics, proteomics, and metabolomics data

    • Correlate SQP1,2 expression with sterol profiles and other metabolites

    • Use network analysis to identify regulatory relationships

    This approach has been successfully implemented for sterol metabolism studies, revealing regulatory networks between sterol-related differentially expressed genes and transcription factors .

  • QTL-Transcriptome Integration:

    • Identify quantitative trait loci (QTL) associated with sterol content

    • Compare QTL regions with SQP1,2 genomic location

    • Integrate with transcriptome data to identify candidate genes within QTL regions

    Previous research has identified 24 QTL and 157 mQTL associated with total sterol and individual sterol contents in Brassica napus , providing valuable reference data for integrating SQP1,2 studies.

  • Comparative Analysis Across Species:

    • Compare SQP1,2 function with homologues in related species

    • Analyze evolutionary conservation and divergence

    • Transfer knowledge from model systems like Arabidopsis thaliana

What is the significance of SQP1,2 in breeding Brassica napus varieties with modified sterol content?

Squalene monooxygenase plays a crucial role in determining sterol content and composition in Brassica napus, making SQP1,2 a valuable target for breeding programs aimed at modifying sterol profiles. The significance is multifaceted:

  • Genetic Marker Development:

    • SNPs and expression variations in SQP1,2 can be developed into molecular markers

    • These markers can be used in marker-assisted selection for desired sterol profiles

    • Integration with existing QTL data for sterol content enables precision breeding approaches

  • Nutritional Quality Improvement:

    • Sterols in rapeseed have significant human health benefits

    • Breeding varieties with enhanced sterol content could improve the nutritional value

    • Targeted modification of specific sterol components may be achieved through SQP1,2 variant selection

  • Experimental Validation Approach:

    • Generate lines with contrasting SQP1,2 alleles or expression levels

    • Conduct field trials under various environmental conditions

    • Analyze sterol content stability across environments

    • Assess yield and agronomic performance correlations with SQP1,2 variants

The potential impact is substantial, as demonstrated by research showing that variations in sterol biosynthesis genes correlate with significant differences in total sterol content between different genotypes of Brassica napus .

How can structure-function studies of SQP1,2 contribute to understanding enzyme evolution in the Brassicaceae family?

Structure-function studies of SQP1,2 provide valuable insights into enzyme evolution within Brassicaceae:

  • Phylogenetic Analysis Framework:

    • Construct comprehensive phylogenetic trees of squalene monooxygenase homologues

    • Include sequences from Brassica napus, B. oleracea, B. rapa, and Arabidopsis thaliana

    • Analyze evolutionary relationships and selection pressures

    • Identify conserved domains versus variable regions

  • Structural Comparison Methodology:

    • Use AlphaFold or similar tools to predict protein structures of SQP1,2 variants

    • Compare with structures of homologous proteins from related species

    • Identify structural features unique to Brassica napus or specific to SQP1,2

  • Splice Site Analysis:

    • Examine junctional sliding phenomena observed in squalene epoxidase homologues

    • Compare intron-exon structures across species

    • Assess the impact on protein function and evolution

Research has shown that squalene monooxygenase homologues in Brassica napus exhibit interesting evolutionary patterns, with some genes like BnSQS1.C03 and BnSQS1.A08 showing stronger similarity to genes from B. oleracea, suggesting acquisition through evolutionary history .

What are the current technical challenges in crystallizing and determining the structure of plant squalene monooxygenases?

Determining the crystal structure of plant squalene monooxygenases presents several technical challenges that researchers should consider:

  • Membrane Association Challenges:

    • The transmembrane domain in squalene monooxygenases complicates crystallization

    • Strategies include:

      • Removing transmembrane regions while preserving enzymatic function

      • Using appropriate detergents for solubilization

      • Employing lipid cubic phase crystallization methods

  • Protein Stability Issues:

    • Plant squalene monooxygenases often display instability during purification

    • Solutions include:

      • Screening multiple buffer conditions and additives

      • Introducing stabilizing mutations

      • Co-crystallization with inhibitors or substrate analogues

      • Implementing strategies from successful crystallization of human squalene epoxidase

  • Comparative Approach:

    • Utilize structural information from human squalene epoxidase (2.3 Å and 2.5 Å resolution structures)

    • Apply molecular replacement techniques using human SQLE as a template

    • Identify conserved catalytic residues based on cross-species comparison

The first high-resolution crystal structures of human squalene epoxidase with small molecule inhibitors have only recently been determined (2.3 Å and 2.5 Å) , highlighting the technical difficulty of this work. These structures revealed conformational rearrangements upon inhibitor binding and provided insights into structure-activity relationships , offering a valuable template for similar studies with plant homologues.

What are the optimal conditions for assessing the impact of different substrates and inhibitors on SQP1,2 activity?

For comprehensive assessment of substrate specificity and inhibitor effects on SQP1,2 activity, implement the following optimized protocol:

  • Substrate Specificity Analysis:

    • Test natural substrate (squalene) at concentrations ranging from 1-100 μM

    • Evaluate substrate analogues with structural variations

    • Determine kinetic parameters (Km, Vmax) for each substrate

    • Plot Lineweaver-Burk graphs for comparative analysis

  • Inhibitor Screening Methodology:

    • Categorize inhibitors based on mechanism (competitive, non-competitive, uncompetitive)

    • Test concentration ranges from 0.1-100 μM

    • Calculate IC50 values and inhibition constants (Ki)

    • For mechanistic studies, include preincubation steps to identify time-dependent inhibition

  • Analytical Detection Methods:

    • HPLC-UV for standard analysis (sensitivity ~1 μM)

    • LC-MS/MS for enhanced sensitivity (detection limits ~10 nM)

    • Consider radiometric assays with [14C]-labeled substrates for highest sensitivity

  • Data Analysis Framework:

    • Apply appropriate enzyme kinetic models

    • Use global fitting approaches for complex inhibition patterns

    • Correlate structural features of inhibitors with potency to develop structure-activity relationships

This approach allows for detailed characterization of SQP1,2's catalytic properties and identification of potent, selective inhibitors, following the scientific principles applied in human squalene epoxidase studies where inhibitor binding revealed important conformational rearrangements .

How can I design CRISPR/Cas9 experiments to study SQP1,2 function in Brassica napus?

Designing effective CRISPR/Cas9 experiments for SQP1,2 functional studies requires careful planning:

  • Target Site Selection:

    • Analyze SQP1,2 gene structure to identify optimal target sites

    • Focus on early exons to ensure complete loss of function

    • Perform in silico analysis to minimize off-target effects

    • Consider targeting conserved functional domains (FAD binding domain)

  • Guide RNA Design Strategy:

    • Design multiple sgRNAs (3-4) targeting different exons

    • Optimize GC content (40-60%) for efficient cutting

    • Verify specificity against the Brassica napus genome

    • Include appropriate controls (non-targeting sgRNAs)

  • Delivery System Optimization:

    • Agrobacterium-mediated transformation for stable integration

    • Protoplast transfection for transient expression and initial validation

    • Consider tissue culture variables specific to Brassica napus

  • Mutation Detection and Characterization:

    • PCR amplification followed by Sanger sequencing

    • T7E1 or Surveyor nuclease assays for initial screening

    • Next-generation sequencing for comprehensive mutation profiling

    • RT-PCR and Western blotting to confirm loss of expression

  • Phenotypic Analysis Protocol:

    • Assess sterol profiles using GC-MS or LC-MS

    • Conduct detailed growth and development analyses

    • Evaluate stress responses and physiological parameters

    • Compare results with other sterol biosynthesis gene mutations

This comprehensive approach enables precise functional characterization of SQP1,2, building on successful gene editing strategies demonstrated in related research .

What emerging technologies could enhance our understanding of SQP1,2 function in sterol biosynthesis?

Several cutting-edge technologies hold promise for advancing SQP1,2 research:

  • Single-Cell Transcriptomics:

    • Map SQP1,2 expression at cellular resolution

    • Identify cell type-specific regulation patterns

    • Reveal coordinated expression with other pathway genes

    • Detect rare cell populations with unique expression profiles

  • Cryo-EM Technology Applications:

    • Overcome crystallization challenges for membrane-associated enzymes

    • Achieve high-resolution structural information (potentially sub-3Å)

    • Capture different conformational states during catalytic cycle

    • Visualize protein-protein interactions with pathway partners

  • Proteomics Advances:

    • Apply proximity labeling techniques (BioID, APEX) to identify interaction partners

    • Use hydrogen-deuterium exchange mass spectrometry to map conformational changes

    • Employ thermal proteome profiling to identify novel inhibitors

    • Develop targeted proteomics methods for accurate quantification

  • Genome Editing Enhancements:

    • Prime editing for precise nucleotide changes without double-strand breaks

    • Base editing for specific mutations without donor DNA

    • Multiplex editing to target several pathway genes simultaneously

    • Inducible CRISPR systems for temporal control of gene function

  • Metabolic Flux Analysis:

    • Apply 13C-labeling studies to track carbon flow through the sterol pathway

    • Quantify flux changes in SQP1,2 variants or under different conditions

    • Develop computational models integrating enzyme kinetics and metabolite levels

    • Identify rate-limiting steps and regulatory nodes in the pathway

These technological approaches, integrated with the multi-omics strategies already being applied in Brassica napus research , will significantly advance our understanding of SQP1,2's role in sterol biosynthesis and plant metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.