Recombinant Brassica napus Uncharacterized mitochondrial protein ORF138

Shipped with Ice Packs
In Stock

Description

Introduction

Brassica napus, commonly known as rapeseed, is an economically important crop worldwide. Cytoplasmic male sterility (CMS) is a maternally inherited trait in plants that prevents the production of functional pollen, but maintains female fertility . The mitochondrial genome of B. napus contains several open reading frames (ORFs), including orf138, which has been correlated with Ogura CMS in rapeseed cybrids . Recombinant Brassica napus uncharacterized mitochondrial protein ORF138 is produced using an in vitro E. coli expression system .

Identification and Characterization of orf138

The orf138 gene was identified through comparisons of mitochondrial genomes of male-sterile and fertile revertant lines of Brassica napus cybrids . The orf138 gene is located on a 2.5 kb NcoI fragment termed Nco2.5/13S . Grelon et al. (1994) demonstrated that orf138 is translated into a mitochondrial membrane protein in sterile cybrids .

Expression Analysis

Expression studies have shown a strong correlation between orf138 expression and Ogura CMS in rapeseed cybrids . The steady-state level of orf138 mRNA differs among various configurations of the gene .

  • The orf138 transcript from Bam4.8/18S in sterile cybrid 18S is 10-fold more abundant than that from Nco2.5/13S in sterile cybrid 13S .

  • No orf138 transcript is detected from Nco2.7/13F in fertile cybrid 13F .

  • These differences in mRNA accumulation are not due to variations in mitochondrial DNA copy number, but rather to post-transcriptional regulation, likely involving the 3' region of the mRNA .

Post-Transcriptional Regulation

Post-transcriptional regulation plays a crucial role in controlling orf138 expression . The 3' untranslated regions (UTRs) of the orf138 gene influence mRNA stability . In vitro decay assays have demonstrated that synthetic RNAs corresponding to the 3' region of the Nco2.7/13F transcript are less stable compared to those from Nco2.5/13S and Bam4.8/18S .

Comparative Mitochondrial Genome Analysis

Comparative analysis of mitochondrial genomes from various Brassica napus lines revealed significant insights into cytoplasmic male-sterility . Four ORFs (orf102a, orf122b, orf138a, and orf154a) from radish were specifically identified in the Ogura CMS mitochondrial genome . Orf138a was found to be co-transcribed with atp8 and trnfM .

Chaperonin-60 Proteins in Brassica napus

Chaperonin-60 proteins, essential for protein folding, have been purified and characterized from Brassica napus . These proteins are found in both plastids and mitochondria . The mitochondrial chaperonin-60 proteins consist of at least three 60-kD polypeptides, some of which are immunologically distinct .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipments.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Uncharacterized mitochondrial protein ORF138
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Brassica napus (Rape)
Target Protein Sequence
MITFFEKLSTFCHNLTPTECKVSVISFFLLAFLLMAHIWLSWFSNNQHCLRTMRHLEKLK IPYEFQYGWLGVKITIKSNVPNDEVTKKVSPIIKGEIEGKEEKKEGKGEIEGKEEKKEGK GEIEGKEEKKEVENGPRK
Uniprot No.

Target Background

Function
This protein may be involved in cytoplasmic male sterility (CMS) by inducing pollen abortion. It is not expressed in fertile plants.
Subcellular Location
Mitochondrion membrane; Single-pass membrane protein.

Q&A

What is ORF138 and what is its role in Brassica napus?

ORF138 is a mitochondrial gene that encodes a membrane protein whose expression is strongly correlated with Ogura cytoplasmic male sterility in Brassica species including B. napus (rapeseed). The gene was originally identified through comparison of mitochondrial genomes between male-sterile and fertile plants. The ORF138 protein accumulates in all plant tissues of sterile plants and plays a critical role in preventing the production of functional pollen while maintaining female fertility . This unique characteristic makes ORF138 particularly valuable for hybrid seed production systems in Brassica crops.

How does the Ogura CMS system relate to different Brassica crop species?

The Ogura CMS system has been introduced into various Brassica species, including important crops like B. napus (rapeseed), B. rapa (turnip rape), B. juncea (Indian mustard), and B. oleracea varieties (kales, cabbage, Brussels sprouts, cauliflower, broccoli, and calabrese) . The system was originally identified in radish and transferred to Brassica species through protoplast fusion, creating cybrids with novel mitochondrial genome arrangements . This transfer allowed genetic recombination between mitochondrial genomes of different species, creating new associations of sequences that have been exploited for hybrid breeding in multiple Brassica crops with significant agricultural importance in both warm and cool growing regions .

What are the different configurations of the ORF138 gene and how do they affect expression?

Research has identified three distinct configurations of the ORF138 gene in Brassica cybrids:

ConfigurationCybridFertility StatusORF138 Transcript LevelProtein DetectionKey Features
Nco2.5/13S13SSterileModeratePresentDistinct 3' region
Nco2.7/13F13FFertileNot detectableNot detectableUnstable 3' region
Bam4.8/18S18SSterileHigh (10× more than 13S)PresentEnhanced stability

These configurations have identical 5' regions but different 3' regions. Run-on experiments demonstrate that all three configurations are transcribed at similar rates, indicating that differences in steady-state mRNA levels are determined post-transcriptionally . The 3' region variations significantly impact RNA stability, with the Nco2.7/13F transcript being notably less stable than the others, explaining the absence of detectable ORF138 expression in fertile plants .

How is ORF138 expression regulated at the post-transcriptional level?

ORF138 expression is primarily regulated through two distinct post-transcriptional mechanisms:

  • mRNA stability: In vitro decay studies demonstrate that the 3' regions of different ORF138 configurations significantly affect transcript stability. RNAs corresponding to the 3' region of the Nco2.7/13F transcript (fertile phenotype) are less stable than those corresponding to the 3' regions of Nco2.5/13S and Bam4.8/18S transcripts (sterile phenotypes) .

  • Protein regulation: In plants containing nuclear restorer genes (Rf), the accumulation of ORF138 protein is dramatically reduced despite unchanged ORF138 RNA levels. This indicates that restorer genes act either on translation efficiency or protein stability without affecting transcription .

These mechanisms represent distinct control points for ORF138 expression and directly impact the male sterility phenotype, highlighting the complexity of nuclear-mitochondrial interactions in the CMS system.

What signaling pathways are implicated in ORF138-mediated sterility and fertility restoration?

Several key signaling pathways and hub genes have been implicated in ORF138-mediated sterility and fertility restoration:

  • Target of rapamycin (TOR) kinase pathway: This pathway is particularly enriched in co-expressed networks associated with fertility restoration when ORF138 is knocked out. Evidence suggests TOR controls respiratory metabolism and directs central metabolism for energy and biomass production, potentially linking mitochondrial function to fertility .

  • Carbon flux regulation: Research hypothesizes that carbon flux is involved in pollination signaling of fertility reversion in CMS plants, potentially connecting to the TOR signaling pathway .

  • Mitochondria-to-nucleus signaling: A proposed mitochondria-to-nucleus signaling pathway may explain how CMS-associated genes like ORF138 affect nuclear gene expression and pollen development .

Additionally, several hub genes have been identified as potential mediators of these pathways, including SDH1-1 (downregulation causes pollen abortion), MSI1 (loss arrests pollen development), and SKB1 (involved in flower development) .

What gene editing approaches have been successful for ORF138 manipulation?

Recent research has successfully employed mitochondrial-targeted transcription activator-like effector nucleases (mitoTALENs) to knock out ORF138 in CMS broccoli hybrids. The approach involves:

  • Design of mitoTALENs vectors specifically targeting the upstream region of ORF138

  • Generation of transgenic plants through Agrobacterium-mediated transformation

  • Selection and verification of knockout lines

  • Assessment of inheritance stability of the ORF138 knockout

This approach successfully generated twelve independent transgenic lines with stable inheritance of the ORF138 knockout, representing the first successful editing of ORF138 in Ogura CMS . The technique provides a valuable tool for creating genetic resources for Brassicaceae crop improvement and a platform for studying the function of ORF138 in male fertility regulation.

What techniques are effective for analyzing ORF138 expression at transcriptional and post-transcriptional levels?

Researchers employ several complementary techniques to comprehensively analyze ORF138 expression:

  • Transcriptional rate analysis: Run-on experiments with isolated mitochondria incubated with radiolabeled nucleotides measure transcription rates of different ORF138 configurations .

  • mRNA quantification: Slot blots with controlled quantities of total RNA, hybridized with an ORF138 probe, quantify steady-state mRNA levels. Northern blots assess transcript size and abundance .

  • Transcript end mapping: Primer extension experiments map the 5' ends of ORF138 transcripts. Research has identified three primary 5' termini at positions 105, 106, and 107 nucleotides upstream from the ORF138 start codon .

  • RNA stability analysis: In vitro decay and processing systems analyze the role of 3' regions in RNA stability, revealing critical differences between fertile and sterile configurations .

  • Protein detection: Western blot analysis using antibodies against ORF138 detects protein presence and abundance in different tissues and genetic backgrounds.

These methods collectively provide a comprehensive picture of the complex regulation of ORF138 expression.

How can researchers assess the functionality of pollen in ORF138 knockout lines?

Researchers use multiple complementary approaches to assess pollen functionality in ORF138 knockout lines:

  • Morphological examination: Visual inspection of anthers for clinandrium development and microsporocyte formation using microscopy .

  • Pollen viability testing: Alexander's staining technique to determine if pollen is functional .

  • In vitro germination assays: Testing pollen germination capability in artificial medium .

  • In situ pollen tube growth: Aniline blue staining to visualize pollen tube formation on stigmatic cells .

  • Cross-pollination experiments: Pollinating fertile lines with pollen from ORF138 knockout plants to verify fertilization capability .

  • Seed development assessment: Observing silique development and seed formation following successful pollination .

In a recent study, these methods revealed that ORF138 knockout lines produced functional pollen capable of germination in vitro and successful cross-pollination, despite being unable to self-pollinate due to the self-incompatibility characteristic of B. oleracea species .

What phenotypic changes are associated with ORF138 knockout in Brassica species?

ORF138 knockout affects multiple aspects of plant development:

TraitCMS Hybrid (with ORF138)ORF138 Knockout LineSignificance
Flower sizeStandardSlightly largerAltered floral morphology
Anther developmentNo visible clinandriumFour clinandrium with well-developed microsporocytesCritical for male fertility
Pollen productionNo functional pollenFunctional pollen capable of germinationEssential for fertility
Temperature responseMale sterileFertile at high temperature, sterile at low temperatureTemperature-sensitive fertility
Cross-compatibilityN/A (sterile)Pollen can fertilize other linesUseful for breeding

These phenotypic changes demonstrate that ORF138 influences not only male fertility but also other aspects of floral development and environmental responsiveness . The temperature-sensitive fertility of knockout lines is particularly noteworthy, suggesting complex interactions between ORF138 and temperature-responsive developmental pathways.

How can ORF138 manipulation be utilized in hybrid breeding programs?

ORF138 manipulation offers several advantages for hybrid breeding programs:

  • Development of fertility restoration lines: ORF138 knockout in CMS-derived hybrids creates fertility-restored lines that can serve as pollinators in hybrid seed production .

  • Accelerated breeding cycles: Research has implemented an efficient pipeline to accelerate the life cycle of fertility restoration lines from CMS-derived broccoli hybrids .

  • Temperature-adaptable breeding systems: The temperature-sensitive fertility observed in ORF138 knockout lines enables development of breeding systems adapted to specific environmental conditions .

  • Expanded genetic resources: ORF138 knockout creates more genetic diversity for crop improvement by enabling utilization of previously sterile germplasm and facilitating new crosses .

These applications help overcome limitations in traditional hybrid breeding systems and expand the genetic base for Brassicaceae crop improvement, potentially leading to enhanced yield, quality, and resilience in commercially important Brassica crops.

How do 3' regions of different ORF138 configurations influence RNA processing and stability?

The 3' regions of the three ORF138 configurations (Nco2.5/13S, Nco2.7/13F, and Bam4.8/18S) have profound effects on RNA stability despite identical transcription rates. In vitro decay studies demonstrate that synthetic RNAs corresponding to the 3' region of the Nco2.7/13F transcript are significantly less stable than those corresponding to the 3' regions of Nco2.5/13S and Bam4.8/18S transcripts .

Additionally, in vitro processing of synthetic RNAs has been observed at sites corresponding to the natural 3' ends of mRNAs from Nco2.5/13S and Bam4.8/18S . This suggests that specific RNA processing mechanisms recognize these sequences, potentially influencing transcript stability and accumulation.

Understanding these 3' region-mediated effects is crucial because:

  • They represent natural examples of post-transcriptional regulation in plant mitochondria

  • They demonstrate how minor sequence variations can dramatically alter gene expression

  • They provide potential targets for engineered modifications to control ORF138 expression

Further analysis of these 3' regions could reveal regulatory elements and RNA-binding factors involved in mitochondrial gene expression control, with implications beyond CMS.

What are the molecular mechanisms connecting ORF138 expression to temperature-sensitive male sterility?

The observation that ORF138 knockout restores fertility under high temperatures but triggers cold-sensitive male sterility presents an intriguing research question. This temperature-dependent phenotype suggests complex interactions between ORF138 and temperature-responsive pathways in pollen development .

Several hypotheses warrant investigation:

  • Mitochondrial energy production: Temperature may affect mitochondrial function differently in the presence or absence of ORF138, altering energy availability during pollen development.

  • Alternative sterility factors: ORF138 knockout may unmask or activate alternative sterility factors that are specifically responsive to cold temperatures.

  • Target of rapamycin (TOR) signaling: The TOR pathway, implicated in fertility restoration, may have temperature-dependent activity that interacts with ORF138-mediated effects .

  • Compensatory mechanisms: Cold temperatures may interfere with compensatory mechanisms that otherwise enable fertility in ORF138 knockout plants.

Understanding these mechanisms would provide fundamental insights into plant reproductive biology and could enable the development of temperature-optimized breeding systems for different growing environments.

How do nuclear restorer genes counteract ORF138 effects at the molecular level?

Potential mechanisms that warrant further investigation include:

  • Translational inhibition: Restorer gene products may bind to ORF138 transcripts and prevent translation, possibly through interaction with specific RNA structures or sequences.

  • Protein degradation: Restorer genes may encode or regulate proteases that specifically target ORF138 protein for degradation.

  • Protein modification: Post-translational modifications might alter ORF138 stability or function in the presence of restorer genes.

  • Mitochondrial targeting: Restorer genes may influence the import or membrane insertion of ORF138 in mitochondria.

In B. napus, the restorer locus has been shown to affect the transcripts of several mitochondrial genes , suggesting a broader role in mitochondrial genome expression that extends beyond ORF138. Elucidating these mechanisms would enhance our understanding of nuclear-mitochondrial interactions and potentially enable more precise manipulation of male sterility systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.