Recombinant Brassica oleracea 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 (LPAT2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
LPAT2; LPAAT2; 1-acyl-sn-glycerol-3-phosphate acyltransferase 2; Lysophosphatidyl acyltransferase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Brassica oleracea (Wild cabbage)
Target Names
LPAT2
Target Protein Sequence
MAMAAAAVIVPLGILFFISGLVVNLLQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWI VDWWAGVKIQVFADDETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKK SSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFVEGTRFTEAK LKAAQEYAATSQLPVPRNVLIPRTKGFVSAVSNMRSFVPAIYDMTVAIPKTSPPPTMLRL FKGQPSVVHVHIKCHSMKDLPESEDEIAQWCRDQFVAKDALLDKHIAADTFPGQKEQNID RPIKSLAVVVSWACLLTLGAMKFLHWSNLFSSLKGIALSALGLGIITLCMQILIRSSQSE RSTPAKVAPAKPKDKHQSGSSSQTEVEEKQK
Uniprot No.

Target Background

Function
This recombinant Brassica oleracea 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 (LPAT2) catalyzes the conversion of lysophosphatidic acid (LPA) to phosphatidic acid by acyl moiety incorporation at the sn-2 position.
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is LPAT2 and what role does it play in lipid biosynthesis?

LPAT2 is a key enzyme in the Kennedy pathway involved in triacylglycerol (TAG) biosynthesis. It catalyzes the acylation of lysophosphatidic acid (LPA) to form phosphatidic acid (PA), a critical intermediate in lipid biosynthesis. This enzyme plays a significant role in determining the fatty acid composition of membrane lipids and storage lipids. Studies have demonstrated that LPAT2 from Brassicaceae species promotes the accumulation of very long-chain fatty acids (VLCFAs) in phospholipids, which ultimately affects oil content and composition in seeds . The enzyme is particularly important in oil-producing crops like Brassica species, where it contributes to TAG accumulation during seed development .

How is LPAT2 conserved across Brassicaceae species?

Phylogenetic analyses reveal high conservation of LPAT2 across Brassicaceae species. Synteny analysis has shown that LPAT2 genes from B. napus are closely related to LPAT genes in A. thaliana, B. oleracea, and B. rapa . The function of class A LPAT in promoting VLCFAs accumulation is conserved among representative oil crops of Brassicaceae, including Camelina sativa, Arabidopsis thaliana, Brassica napus, Brassica rapa, and Brassica oleracea .

Gene duplication or triplication events appear to have occurred in these species, as reflected by multiple homologs in each genome: A. thaliana has 1 LPAT2 homolog, B. oleracea has 3, B. rapa has 3, and B. napus has 7 . This complex evolutionary trajectory suggests the functional importance of LPAT2 in these species.

What are the recommended methods for expressing recombinant B. oleracea LPAT2?

For optimal expression of recombinant B. oleracea LPAT2, the following methodological approach is recommended:

  • Expression System Selection: E. coli is the preferred heterologous expression system for B. oleracea LPAT2, offering high yield and relative simplicity .

  • Construct Design:

    • Clone the full-length coding sequence (1-391 amino acids) into an expression vector with an N-terminal His-tag for purification

    • Use a strong promoter (e.g., T7) for high-level expression

    • Optimize codon usage for E. coli if necessary

  • Culture Conditions:

    • Grow cultures at 37°C until OD600 reaches 0.6-0.8

    • Induce protein expression with IPTG (0.1-1.0 mM)

    • Lower the temperature to 16-20°C during induction to enhance proper folding

    • Continue expression for 16-20 hours

  • Protein Extraction and Purification:

    • Lyse cells using appropriate buffer systems containing detergents to solubilize the membrane-associated protein

    • Purify using Ni-NTA affinity chromatography

    • Consider adding glycerol (5-50%) to stabilize the protein during purification

The purified protein is typically obtained as a lyophilized powder and can be reconstituted in appropriate buffers for enzymatic assays .

How can CRISPR-Cas9 be effectively applied to study LPAT2 function?

CRISPR-Cas9 has proven effective for studying LPAT2 function, particularly in polyploid species like B. napus with multiple gene copies. Based on successful implementations, the following methodology is recommended:

This approach has successfully achieved mutation frequencies of 17-68% in B. napus LPAT genes with minimal off-target effects .

What analytical techniques are essential for characterizing LPAT2 enzymatic activity?

To properly characterize LPAT2 enzymatic activity, researchers should employ these analytical approaches:

  • In Vitro Activity Assays:

    • Substrate preparation: lysophosphatidic acid (LPA) and acyl-CoA donors

    • Reaction conditions: optimized buffer, pH, temperature, and cofactors

    • Product detection: radiolabeled substrates or mass spectrometry-based methods

  • Lipid Profiling:

    • Extraction of total lipids using chloroform/methanol methods

    • Fractionation of lipid classes by thin-layer chromatography (TLC) or solid-phase extraction

    • Analysis of phospholipid and TAG species by LC-MS/MS

    • Fatty acid profiling by gas chromatography-mass spectrometry (GC-MS)

  • Substrate Preference Analysis:

    • Competition assays with different acyl-CoA donors

    • Determination of kinetic parameters (Km, Vmax) for various substrates

    • Position-specific analysis of incorporated fatty acids

  • Protein-Protein Interaction Studies:

    • Pull-down assays to identify interaction partners

    • Bimolecular fluorescence complementation for in vivo interaction studies

    • Co-immunoprecipitation to confirm interactions

These techniques collectively provide a comprehensive assessment of LPAT2 function, substrate specificity, and its role in lipid metabolism pathways.

How does manipulation of LPAT2 affect oil body formation and lipid content?

Manipulation of LPAT2 has significant effects on oil body morphology and lipid content:

Knockout Effects:
CRISPR-Cas9-mediated knockout of LPAT2 in B. napus resulted in:

  • Enlarged oil bodies with disrupted distribution in mature seeds

  • Decreased oil content by an average of 32% in single-gRNA LPAT2 knockout lines

  • Decline of 24% in oil content for LPAT2 multi-gRNA mutant lines (g123)

  • Wizened seeds with increased accumulation of starch in mature seeds

Overexpression Effects:
Studies in related plants have shown that overexpression of LPAT2 can:

  • Increase the proportion of phosphatidic acid molecules containing VLCFAs by up to 2.8-fold

  • Increase the proportion of phosphatidylcholine and diacylglycerol molecules containing VLCFAs

  • Slightly increase seed size without an oil content penalty

  • Significantly increase total phospholipid content in seeds

These findings demonstrate that LPAT2 is a critical determinant of oil body formation and lipid content in Brassica species, making it a valuable target for engineering oil crops.

What is the relationship between LPAT2 and LPAT5 in lipid biosynthesis?

LPAT2 and LPAT5 appear to have both overlapping and distinct functions in lipid biosynthesis:

  • Functional Overlap:

    • Both are involved in the Kennedy pathway for TAG biosynthesis

    • Both influence oil content in seeds

    • Double knockout of LPAT2/LPAT5 (g134) resulted in a more dramatic 39% reduction in oil content compared to single knockouts

  • Distinct Roles:

    • LPAT2 appears to have a more significant role in seed oil production than LPAT5

    • LPAT2 shows greater ability to incorporate VLCFAs into phospholipids

    • LPAT5 knockout alone reduced oil content by 29%, while LPAT2 knockout reduced it by 32%

  • Evolutionary Relationship:

    • Phylogenetic analysis reveals they belong to different clades of the LPAT family

    • LPAT2 has undergone more extensive gene duplication (7 homologs in B. napus) compared to LPAT5 (4 homologs)

This relationship suggests that both enzymes contribute to oil biosynthesis, but LPAT2 may have a more specialized role in determining oil composition, particularly regarding VLCFA incorporation.

How does LPAT2 influence the incorporation of very long-chain fatty acids (VLCFAs)?

LPAT2 plays a crucial role in VLCFA incorporation into complex lipids:

  • Substrate Specificity:

    • LPAT2 from Brassicaceae species can effectively utilize VLCFA-CoAs as substrates

    • It can incorporate VLCFAs into the sn-2 position of phosphatidic acid

    • This activity was previously thought to be limited in class A LPATs

  • Metabolic Impact:

    • Overexpression of LPAT2 increases VLCFA content in triacylglycerol

    • Specific VLCFAs that increase include C20:0, C20:2, C20:3, C22:0, and C22:1

    • The proportion of phosphatidic acid molecules containing VLCFAs can reach up to 45%

    • Increased VLCFA content in phosphatidylcholine and diacylglycerol is also observed

  • Bottleneck Resolution:

    • LPAT2 helps overcome the bottleneck of low VLCFA incorporation into phosphatidylcholine

    • This facilitates the movement of VLCFAs through the Kennedy pathway to final incorporation into TAG

This ability to incorporate VLCFAs makes LPAT2 a valuable target for engineering crops to produce specialty oils rich in industrially important VLCFAs.

What bioinformatic approaches are recommended for analyzing LPAT2 homology across species?

For comprehensive analysis of LPAT2 homology across species, researchers should employ these bioinformatic approaches:

  • Sequence Retrieval and Database Mining:

    • Extract protein sequences from specialized databases like Brassica Database (http://brassicadb.org/brad/)

    • Use BLAST searches against genome databases to identify potential homologs

  • Multiple Sequence Alignment:

    • Align LPAT2 sequences using tools like MUSCLE, MAFFT, or Clustal Omega

    • Identify conserved domains and catalytic motifs

    • Visualize alignments using Jalview or similar tools

  • Phylogenetic Analysis:

    • Construct phylogenetic trees using Maximum Likelihood or Bayesian methods

    • Bootstrap analysis (>1000 replicates) to assess tree reliability

    • Use tools like MEGA, RAxML, or MrBayes for tree construction

  • Synteny Analysis:

    • Examine genomic context and gene order conservation

    • Identify syntenic blocks containing LPAT2 across genomes

    • Use tools like SynMap in CoGe or MCScanX

  • Gene Duplication Analysis:

    • Identify orthologous and paralogous relationships

    • Calculate synonymous (Ks) and non-synonymous (Ka) substitution rates

    • Estimate divergence times of gene duplication events

  • Protein Structure Prediction:

    • Generate 3D models using homology modeling or AlphaFold2

    • Analyze conservation patterns in structural context

    • Identify functionally important residues

These approaches have successfully revealed the evolutionary history of LPAT2 in Brassicaceae, showing gene duplication/triplication events and conservation patterns across species .

How can researchers quantify changes in lipid profiles resulting from LPAT2 manipulation?

To accurately quantify lipid profile changes resulting from LPAT2 manipulation, researchers should use this comprehensive analytical workflow:

This methodology has successfully detected significant changes in VLCFA content in TAG (up to 2.8-fold increase) and phospholipids in LPAT2-manipulated plants .

What are the key considerations when interpreting contradictory findings in LPAT2 functional studies?

When faced with contradictory findings in LPAT2 functional studies, researchers should consider these key factors:

  • Species-Specific Variations:

    • Different Brassica species may show variations in LPAT2 function

    • Paralogous genes might have undergone subfunctionalization

    • Enzyme activity may be influenced by species-specific factors

  • Experimental Design Differences:

    • Expression systems (in vitro vs. heterologous vs. homologous)

    • Knockout strategies (complete vs. partial, single vs. multiple genes)

    • Overexpression levels and promoter choices

  • Genetic Background Effects:

    • Interactions with other genes in the lipid biosynthesis pathway

    • Compensatory mechanisms in different genetic backgrounds

    • Presence of functional redundancy with other LPAT isozymes

  • Environmental Influences:

    • Growth conditions affecting lipid metabolism

    • Developmental stage-specific effects

    • Stress responses altering lipid profiles

  • Methodological Considerations:

    • Sensitivity and specificity of analytical techniques

    • Enzyme assay conditions affecting activity measurements

    • Data normalization and statistical analysis approaches

  • Systematic Verification:

    • Reproduce experiments under standardized conditions

    • Employ multiple complementary techniques

    • Use appropriate controls and replicates

A comprehensive analysis combining these considerations will help resolve contradictions and develop a more accurate understanding of LPAT2 function across different experimental contexts and species.

What are the main challenges in studying redundant LPAT homologs in polyploid species?

Studying redundant LPAT homologs in polyploid species like B. napus presents several significant challenges:

  • Genetic Redundancy:

    • Multiple homologous genes (seven for LPAT2, four for LPAT5 in B. napus) with overlapping functions

    • Difficulty in obtaining complete knockouts of all copies simultaneously

    • Compensatory mechanisms masking phenotypic effects of single-gene mutations

  • Sequence Similarity Challenges:

    • High sequence identity complicating specific targeting of individual homologs

    • Risk of off-target effects in gene editing approaches

    • Difficulty in designing homolog-specific primers for expression analysis

  • Genomic Complexity:

    • Complex subgenome interactions in polyploids

    • Differential expression patterns across tissues and developmental stages

    • Epigenetic regulation affecting homolog expression

  • Technical Limitations:

    • Inefficiency of transformation in some Brassica species

    • Low frequency of complete gene knockout in polyploids

    • Challenges in phenotypic analysis due to subtle effects of individual genes

  • Evolutionary Considerations:

    • Neo- and subfunctionalization of duplicated genes

    • Selection pressures affecting different homologs

    • Complex evolutionary trajectories following polyploidization events

Addressing these challenges requires integrated approaches combining advanced genomic tools, comprehensive phenotyping, and sophisticated bioinformatic analyses.

How can advanced microscopy techniques enhance our understanding of LPAT2 function?

Advanced microscopy techniques offer powerful approaches to elucidate LPAT2 function at cellular and subcellular levels:

  • Super-Resolution Microscopy:

    • Visualize LPAT2 localization with precision beyond the diffraction limit

    • Study co-localization with other Kennedy pathway enzymes

    • Observe dynamic changes in enzyme distribution during seed development

  • Cryo-Electron Microscopy:

    • Determine high-resolution structures of LPAT2 in native membrane environments

    • Visualize substrate binding and catalytic mechanisms

    • Study conformational changes during enzymatic activity

  • Live-Cell Imaging:

    • Track LPAT2-fluorescent protein fusions in real-time

    • Monitor dynamic interactions with other lipid biosynthesis enzymes

    • Observe oil body formation processes in living cells

  • Correlative Light and Electron Microscopy (CLEM):

    • Combine fluorescence microscopy with EM to correlate LPAT2 localization with ultrastructure

    • Study structural changes in oil bodies resulting from LPAT2 manipulation

    • Examine membrane topography associated with LPAT2 activity

  • Fluorescence Resonance Energy Transfer (FRET):

    • Investigate protein-protein interactions between LPAT2 and other Kennedy pathway enzymes

    • Study conformational changes during substrate binding

    • Measure activity in situ using FRET-based biosensors

These approaches would complement the observed phenotypic changes in LPAT2 mutants, where enlarged oil bodies with disrupted distribution were observed in mature seeds , providing mechanistic insights into how LPAT2 influences oil body formation and lipid deposition.

What emerging technologies hold promise for advancing LPAT2 engineering for improved oil quality?

Several emerging technologies show significant promise for LPAT2 engineering to improve oil quality in Brassica crops:

  • Prime Editing and Base Editing:

    • Make precise single nucleotide changes without double-strand breaks

    • Engineer subtle modifications to alter substrate specificity

    • Introduce specific amino acid changes to optimize enzyme performance

    • Reduce off-target effects compared to conventional CRISPR-Cas9

  • Synthetic Biology Approaches:

    • Design artificial LPAT2 variants with enhanced VLCFA incorporation capability

    • Create synthetic regulatory circuits to control LPAT2 expression

    • Engineer metabolic channeling between LPAT2 and other Kennedy pathway enzymes

    • Develop synthetic protein scaffolds to optimize pathway flux

  • Single-Cell Omics:

    • Analyze cell-specific LPAT2 expression patterns during seed development

    • Identify key regulatory networks controlling oil biosynthesis

    • Understand cell-to-cell variability in lipid metabolism

    • Target engineering efforts to specific cell types

  • Artificial Intelligence and Machine Learning:

    • Predict optimal LPAT2 sequence variants for desired oil profiles

    • Model complex interactions in lipid biosynthesis pathways

    • Design multi-gene engineering strategies for coordinated pathway optimization

    • Accelerate screening of engineered variants

  • Nanobiotechnology:

    • Develop nanoscale tools for precise enzyme delivery

    • Create nanosensors to monitor LPAT2 activity in vivo

    • Design nanocarriers for targeted delivery of engineering components

These technologies could overcome current limitations in LPAT2 engineering and enable the development of Brassica varieties with customized oil compositions for industrial applications, particularly those requiring high VLCFA content .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.