Recombinant Brassica oleracea Ethylene receptor 1 (ETR1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ETR1; Ethylene receptor 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-735
Protein Length
full length protein
Species
Brassica oleracea (Wild cabbage)
Target Names
ETR1
Target Protein Sequence
MEVCNCIEPQWPADELLMKYQYISDFFIAVAYFSIPLELIYFVKKSAVFPYRWVLVQFGA FIVLCGATHLINLWTFTTHSRTVALVMTTAKVLTAVVSCATALMLVHIIPDLLSVKTREL FLKNKAAELDREMGLIRTQEETGRHVRMLTHEIRSTLDRHTILKTTLVELGRTLALEECA LWMPTRTGLELQLSYTLRQQHPVEYTVPIQLPVINQVFGTSRAVKISPNSPVARLRPVSG KYLLGEVVAVRVPLLHLSNFQINDWPELSTKRYALMVLMLPSDSARQWHVHELELVEVVA DQVAVALSHAAILEESMRARDLLMEQNVALDIARREAETAIRARNDFLAVMNHEMRTPMH AIIALSSLLQETELTPEQRLMVETVLKSSSLLATLMNDVLDLSRLEDGSLQLELGTFNLH TLFREVLNLIKPIAVVKKLPITLNLAPDLPEFVVGDEKRLMQIILNIVGNAVKFSKQGSI SVTALVTKSDNRAPPDFFVVPTGSHFYLRVKVKDLGAGINPQDIPKLFTKFAQTQSLATR SSGGSGLGLAISKRFVNLMEGNIWIESEGVGKGCTAIFDVKLAISNESKQSGIPKVPANP QHVNFAGLKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVSHEHRVVFMDVCT PGVENYQIALRIHEKFTKRHQRPLLVALTGNTDKSTKEKCMSFGLDGVLLKPVSLDNMRN VLSDRLEHRVLYEAM
Uniprot No.

Target Background

Function
This protein may play an early role in ethylene signal transduction, potentially functioning as an ethylene receptor or a pathway regulator.
Protein Families
Ethylene receptor family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the structural organization of ETR1 in Brassica oleracea compared to model plants?

Ethylene Receptor 1 (ETR1) in Brassica oleracea belongs to the subfamily I of ethylene receptors, similar to its ortholog in Arabidopsis thaliana. The receptor contains multiple functional domains including an N-terminal transmembrane ethylene-binding domain, a GAF domain, a histidine kinase domain, and a receiver domain. Comparative analysis reveals strong conservation of these domains between B. oleracea and A. thaliana ETR1, particularly in the ethylene-binding region where copper serves as a cofactor for ethylene binding . This structural conservation suggests functional similarity, though species-specific variations exist that may influence receptor activity in the Brassica genus.

The domain organization is particularly important when designing recombinant ETR1 constructs, as truncation or modification of specific domains can significantly alter receptor function. When planning experiments with recombinant B. oleracea ETR1, researchers should consider that the full-length sequence, including all functional domains, is typically required for proper receptor activity.

How does ETR1 function differ between Arabidopsis and Brassica oleracea?

Despite B. oleracea and A. thaliana being closely related species, there are notable differences in their ETR1 function due to genome duplication events and subsequent evolutionary divergence. Research indicates that while the basic mechanism of ethylene perception is conserved, B. oleracea may exhibit distinct regulatory patterns.

In Arabidopsis, ETR1 has been shown to have the predominant role in ethylene perception and is sufficient for mediating responses to silver ions, which block ethylene perception while supporting ethylene binding to ETR1 . Studies have demonstrated that loss of ETR1 in Arabidopsis significantly reduces the effects of silver, while loss of other ethylene receptors has less pronounced effects .

For B. oleracea, the genetic redundancy resulting from genome replication events (as evidenced by genomic comparison studies) suggests potentially more complex regulation of ethylene responses . When working with recombinant B. oleracea ETR1, researchers should consider these species-specific differences in experimental design and interpretation of results.

What are the critical considerations in designing experiments to study recombinant B. oleracea ETR1?

When designing experiments to study recombinant B. oleracea ETR1, researchers should follow a systematic approach:

  • Define variables clearly: Identify independent variables (e.g., ETR1 expression levels, ethylene concentration, silver ion treatment) and dependent variables (e.g., growth inhibition, senescence parameters, gene expression) .

  • Formulate specific hypotheses: Rather than generally exploring ETR1 function, develop testable hypotheses about specific aspects of receptor activity .

  • Control for extraneous variables: Consider factors that might influence results, such as plant developmental stage, environmental conditions, and endogenous ethylene production .

  • Use appropriate controls: Include wild-type B. oleracea, known ethylene-insensitive mutants, and vector-only transformants as controls.

  • Select appropriate measurement methods: Plan how to quantify ETR1 expression levels and ethylene responses precisely .

What expression systems are most effective for producing functional recombinant B. oleracea ETR1?

The choice of expression system significantly impacts the functionality of recombinant ETR1. Consider the following approaches:

When designing expression constructs, maintain the copper-binding sites in the transmembrane domains, as copper is an essential cofactor for ethylene binding . Additionally, consider that silver can substitute for copper as a cofactor for ethylene binding activity yet inhibit ethylene responses .

How can I validate the functionality of recombinant B. oleracea ETR1?

Validation of recombinant ETR1 functionality requires multiple complementary approaches:

  • Complementation assays: Express recombinant B. oleracea ETR1 in Arabidopsis ethylene receptor mutants (particularly etr1 mutants) to assess functional complementation. As demonstrated with Arabidopsis ETR1, a cETR1 transgene under the promoter control of ETR1 can rescue ethylene response phenotypes .

  • Ethylene binding assays: Confirm that the recombinant receptor can bind ethylene using radiolabeled ethylene binding assays.

  • Silver response tests: Assess whether silver ion treatments affect the recombinant ETR1 similar to native receptors. In Arabidopsis, ETR1 has been shown to have the predominant role in mediating responses to silver ions .

  • Interaction studies: Verify that recombinant ETR1 can form appropriate protein complexes with downstream signaling components using co-immunoprecipitation or yeast two-hybrid approaches.

  • Phenotypic analysis: Evaluate whether typical ethylene responses (growth inhibition, triple response in etiolated seedlings, etc.) are affected in plants expressing the recombinant receptor.

How does ETR1 interact with other ethylene receptors in B. oleracea?

Research in Arabidopsis has demonstrated that ethylene receptors can form higher-order complexes and exhibit collaborative signaling. Similar interactions likely occur in B. oleracea:

  • Receptor collaboration: Different combinations of ethylene receptors can facilitate differential receptor signal output, regulating ethylene activity . In Arabidopsis, ETR1 not only represses ethylene responses but also promotes ethylene responses in an ETR1-dependent manner, implying collaboration among ethylene receptors .

  • Subfamily interactions: ETR1 belongs to subfamily I of ethylene receptors. Research has shown that dominant ethylene-insensitive receptors can exhibit different responses in the background of wild-type ethylene receptors, suggesting complex interactions .

  • Protein complex formation: Receptors form protein complexes to relay signals according to specific cellular environments and responses . These complexes may include both subfamily I and subfamily II receptors, creating a sophisticated signaling network.

When studying recombinant B. oleracea ETR1, researchers should consider these potential receptor interactions, particularly when expressing the recombinant receptor in backgrounds with different receptor compositions.

What role does copper play in ETR1 function, and how does silver affect the receptor?

Copper and silver ions play critical roles in ETR1 function:

IonRole in ETR1Effect on Ethylene ResponseMechanism
CopperEssential cofactorEnables normal ethylene perceptionFacilitates ethylene binding in the receptor's N-terminal domain
SilverSubstitute cofactorBlocks ethylene responsesSupports ethylene binding but prevents normal signal transduction

Importantly, studies have shown that the effects of silver are mostly dependent upon ETR1, and ETR1 alone is sufficient for the effects of silver . Ethylene responses in etr1-6 etr2-3 ein4-4 triple mutants were not blocked by silver, but transformation with cETR1 transgene completely rescued responses to silver .

These findings have significant implications for B. oleracea research, suggesting that recombinant ETR1 studies should consider the differential effects of copper and silver on receptor function.

How can I identify genetic markers associated with ETR1 in B. oleracea for breeding programs?

Identifying ETR1-associated genetic markers for breeding programs involves several approaches:

  • GBS-based genetic mapping: Genotyping-by-sequencing (GBS) approaches have been successfully used to develop genetic linkage maps in B. oleracea, identifying single nucleotide polymorphism (SNP) markers spanning the genome . Similar approaches can be applied to identify markers linked to ETR1.

  • QTL analysis: Phenotyping populations for ethylene-related traits (such as shelf life, senescence timing, or fruit ripening) followed by QTL analysis can identify regions containing ETR1 and associated regulatory elements .

  • Comparative genomics: Utilize the close relationship between B. oleracea and A. thaliana by using explicit criteria to distinguish orthologous from paralogous loci . Collinearity analysis can help identify conserved regions containing ETR1.

  • Physical mapping: The physical position of ETR1 in the B. oleracea genome can be determined by comparing with the well-annotated A. thaliana genome, though genome rearrangements and polyploidization events must be considered .

When designing markers for breeding programs, consider that the B. oleracea genome has been highly rearranged since divergence from A. thaliana, likely as a result of polyploidization . This may affect the transferability of markers between species.

What approaches are effective for identifying ETR1 functional variants in B. oleracea populations?

To identify functional ETR1 variants in B. oleracea populations:

  • EcoTILLING: This modified TILLING (Targeting Induced Local Lesions IN Genomes) approach can identify natural allelic variations in ETR1 across diverse B. oleracea germplasm.

  • Whole-genome resequencing: Analyze multiple B. oleracea accessions to identify SNPs and structural variations in ETR1 and regulatory regions.

  • Functional verification: Express candidate ETR1 variants in Arabidopsis ethylene receptor mutants to assess their impact on ethylene responses. The etr1-6 etr2-3 ein4-4 triple mutant background has been used successfully for testing receptor function .

  • Gene expression analysis: Use qRT-PCR to analyze expression patterns of ETR1 variants in response to ethylene treatment. Differential expression patterns, similar to those observed for candidate genes in disease resistance studies , can provide insights into functional significance.

  • Silver sensitivity testing: As ETR1 has a predominant role in silver-mediated inhibition of ethylene responses , test the sensitivity of different accessions to silver treatments as a proxy for ETR1 functional variation.

How can CRISPR-Cas9 be used to modify ETR1 function in B. oleracea?

CRISPR-Cas9 genome editing offers precise approaches to modify ETR1 function in B. oleracea:

  • Domain-specific modifications: Target specific functional domains (ethylene-binding domain, histidine kinase domain, etc.) to create variants with altered activity rather than complete loss-of-function.

  • Promoter editing: Modify ETR1 regulatory regions to alter expression patterns, potentially enhancing desirable traits like extended shelf life or stress tolerance.

  • Site-directed mutagenesis: Introduce specific amino acid changes based on known functional variants in other species, particularly focusing on the copper-binding sites that are critical for ethylene binding .

  • Reporter gene integration: Insert reporter genes in-frame with ETR1 to facilitate visualization of expression patterns and protein localization without disrupting function.

  • Multiplexed editing: Target multiple ethylene receptors simultaneously to study receptor interactions and functional redundancy, similar to the approach used in creating Arabidopsis receptor mutant combinations .

When designing CRISPR experiments, consider the technical challenges specific to B. oleracea, including efficient transformation protocols, polyploidy (which may require modification of multiple homeologous copies), and potential off-target effects.

What are the key considerations when expressing recombinant B. oleracea ETR1 in heterologous systems?

Heterologous expression of B. oleracea ETR1 requires attention to several factors:

  • Codon optimization: Adjust the coding sequence based on the codon usage bias of the host organism to enhance expression efficiency.

  • Cofactor availability: Ensure availability of copper, which is essential for ETR1 function . In some expression systems, supplementation with copper may be necessary.

  • Membrane integration: As ETR1 is a membrane-bound receptor, select expression systems capable of properly inserting the protein into membranes with correct topology.

  • Post-translational modifications: Consider whether the heterologous system can perform necessary post-translational modifications that may be required for full receptor functionality.

  • Expression level control: Utilize inducible promoters to control expression levels, as overexpression may lead to non-physiological behaviors or toxicity in some systems.

  • Functional verification: Develop appropriate assays to confirm that the heterologously expressed receptor is functional, such as ethylene binding assays or response to silver ions .

Different expression systems offer unique advantages: bacterial systems provide high yield but limited post-translational processing, yeast systems offer eukaryotic processing capabilities, and plant-based systems provide the most native environment for functional studies.

What are common challenges in generating functional recombinant B. oleracea ETR1 and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant ETR1:

ChallengePotential Solution
Poor expression levelsOptimize codon usage, use stronger promoters, or try different expression systems
Protein misfoldingExpress at lower temperatures, use molecular chaperones, or express individual domains separately
Limited membrane integrationUse specialized membrane protein expression systems with appropriate detergents
Loss of copper cofactorSupplement growth media with copper, avoid strong chelating agents during purification
Non-functional proteinVerify proper glycosylation and other post-translational modifications
Protein aggregationUse fusion tags that enhance solubility, optimize buffer conditions

When troubleshooting expression issues, consider that ETR1 in Arabidopsis has been shown to interact with other proteins to form signaling complexes . These interactions may be necessary for stability or proper folding, suggesting that co-expression with interacting partners might improve recombinant protein quality.

How can qRT-PCR be optimized for studying ETR1 expression in B. oleracea?

Optimization of qRT-PCR for ETR1 expression analysis requires attention to several methodological aspects:

  • Reference gene selection: Choose appropriate reference genes that show stable expression across experimental conditions. In B. oleracea studies, 18S rRNA has been used successfully as a normalization control .

  • Primer design: Design primers specific to B. oleracea ETR1, avoiding cross-amplification with paralogous sequences. Consider exon-junction spanning primers to avoid genomic DNA amplification.

  • Expression kinetics: Plan appropriate time points for sampling. ETR1-related gene expression changes can be rapid and transient, as observed in disease resistance studies where significant expression changes were detected at 12, 24, and 48 hours post-treatment .

  • Statistical analysis: Use appropriate statistical methods for analyzing relative expression data. Research on B. oleracea has successfully employed one-way ANOVA with Duncan's multiple range test (α = 0.05) to determine significant differences in gene expression .

  • Validation: Validate qRT-PCR results with alternative methods such as Northern blotting or RNA-seq when possible.

Example time course sampling design based on previous B. oleracea studies:

Time pointPurposeExpected observation
0 h (pre-treatment)Baseline expressionEstablish reference level
12 h post-treatmentEarly responseInitial transcriptional changes
24 h post-treatmentMid-responsePeak expression for many genes
48 h post-treatmentLate responseSustained or secondary responses

This sampling design has successfully captured differential expression patterns in B. oleracea in response to pathogen challenge and could be adapted for ethylene treatment studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.