Recombinant Brassica oleracea Photosystem I assembly protein Ycf4 (ycf4)

Shipped with Ice Packs
In Stock

Description

Function and Significance

Ycf4 is an essential thylakoid membrane protein required for the accumulation of the PSI complex . Specifically, Ycf4, along with Ycf3, is vital for PSI complex accumulation in Chlamydomonas reinhardtii .

Role in Photosynthesis

PSI is a critical component of the photosynthetic electron transport chain, which uses light energy to drive the synthesis of ATP and NADPH. These are the two main products that provide the energy and reducing power for carbohydrate biosynthesis during photosynthesis.

Regulation of Photosynthetic Efficiency

Studies on Brassica oleracea have shown that photosynthetic efficiency, specifically the maximum quantum efficiency of Photosystem II (PSII), can be enhanced by treatments such as pre-sowing soaking in jasmonic acid (JA) and methyl jasmonate (Me-JA) . Although this pertains to PSII, the general photosynthetic efficiency is relevant to the function of PSI and Ycf4 .

Chloroplast Genome Context

The chloroplast genome of Brassica oleracea encodes several components associated with photosynthesis, including photosystems I and II . The complete chloroplast genome consists of genes encoding ribosomal subunits and RNA polymerase, in addition to those directly involved in photosynthesis .

Quantitative Proteomic Analysis

Quantitative proteomic analyses have been performed to study the differentiation of chloroplast membranes and their protein composition in various photosynthetic contexts . These studies help to elucidate the specific roles and quantities of proteins such as Ycf4 in different cellular environments .

J-Proteins and Molecular Chaperones

J-proteins, a class of molecular chaperones, are also present in Brassica oleracea and play roles in protein folding, assembly, and degradation . These proteins may indirectly influence the function and stability of photosynthetic complexes .

Expression under Stress Conditions

The expression of genes associated with Photosystem II (PSII) is differentially regulated in Brassica oleracea under various stress conditions, such as treatment with jasmonic acid (JA) and methyl jasmonate (Me-JA) .

Relevance to Crop Improvement

Understanding the function and regulation of proteins such as Ycf4 can provide insights for genetic improvement of crop plants . Modifying the expression or function of these proteins may enhance photosynthetic efficiency and stress tolerance .

Phylogenetic Analysis

Phylogenetic analysis of J-proteins in Brassica oleracea provides a basis for understanding their classification and function in the broader context of plant biology .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for customers.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is assigned during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ycf4; Photosystem I assembly protein Ycf4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-185
Protein Length
full length protein
Species
Brassica oleracea (Wild cabbage)
Target Names
ycf4
Target Protein Sequence
MTWRSEHIWIDLISGSRKKSNFCWAFLLFLGSLGFVLVGTSSYLGRNLISSFPPQQITFF PQGLVMSFYGIAGLFISCYLWCTILWNVGSGYDLFDRKEGIVRIFRWGFPGKSRRIVLRF LMKDIQSDRTEVKEGVSARRVPYMEIRGQGAIPLIRTDENFTTRREIEQKAAELAYFLRV PIEVF
Uniprot No.

Target Background

Function
Essential for the assembly of the photosystem I complex.
Protein Families
Ycf4 family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What are the standard methodologies for cloning and expressing recombinant Ycf4 protein from Brassica oleracea?

The expression of recombinant Ycf4 typically follows these methodological steps:

  • Gene Isolation: The ycf4 gene (1-185aa region) is amplified from B. oleracea chloroplast DNA using specific primers designed based on the known sequence.

  • Vector Construction: The gene is cloned into an appropriate expression vector (typically with a His-tag for purification) using restriction enzymes or Gibson Assembly methods.

  • Expression System: E. coli is the preferred expression system, as demonstrated in multiple studies .

  • Protein Purification:

    • Initial purification using Ni-NTA affinity chromatography (for His-tagged proteins)

    • Further purification through size exclusion chromatography

    • Verification of purity using SDS-PAGE (aim for >90% purity)

  • Storage and Handling:

    • Store as lyophilized powder

    • Reconstitute in Tris/PBS-based buffer (pH 8.0) with 6% trehalose

    • For long-term storage, add 30-50% glycerol and store at -20°C/-80°C

    • Avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

How is the ycf4 gene organized in the chloroplast genome of Brassica oleracea?

The ycf4 gene in B. oleracea is located in the large single-copy (LSC) region of the chloroplast genome with the following genomic context:

  • Upstream region: rbcL, accD, and psaI genes

  • Downstream region: ycf10, petA, and psbJ genes

In terms of genome boundary analysis, the ycf4 gene is positioned within the LSC region with well-conserved boundaries across different B. oleracea varieties . The chloroplast genome organization follows the quadripartite structure typical of land plants, with:

  • Total genome size of approximately 153,364 bp

  • LSC region: ~83,136 to 83,192 bp (contains ycf4)

  • Two IR regions: identical size across B. oleracea varieties

  • SSC region: conserved size across varieties

This gene organization is important for designing targeted knockout experiments since the flanking sequences are used for homologous recombination events when creating ycf4 mutants .

What phenotypic changes are observed when ycf4 is disrupted in plants?

Disruption of the ycf4 gene leads to distinct phenotypic changes that vary depending on the extent of disruption:

Complete ycf4 knockout effects:

  • Plants unable to survive photoautotrophically

  • Light green phenotype initially, with leaves becoming pale yellow as plants age

  • Growth severely hampered without external carbon supply

  • Requires heterotrophic conditions (30g/L sucrose) for survival, but plants remain stunted

Chloroplast structural abnormalities in ycf4 knockouts:

  • Abnormal chloroplast size and shape (smaller and spherical compared to larger, oblong wild-type chloroplasts)

  • Less organized thylakoid membranes with vesicular structures

  • Disorganization and disintegration of thylakoid membranes

Partial ycf4 knockout effects:

  • When only 93 of 184 amino acids from the N-terminus were knocked out, plants could maintain photoautotrophic growth

  • Lower PSI levels were observed, but not complete loss of photosynthetic ability

This contrast in phenotypes between complete and partial knockouts highlights the critical importance of the C-terminus of Ycf4 for protein function.

What are the key transcriptional characteristics of the ycf4 gene in photosynthetic organisms?

The transcriptional pattern of ycf4 shows important characteristics that inform experimental approaches:

Understanding these transcriptional characteristics is essential for designing experiments that properly capture the gene's expression patterns and for interpreting results in the context of growth stage and physiological conditions.

What methodological approaches are most effective for generating complete vs. partial ycf4 knockout mutants?

The methodological approaches for generating complete versus partial ycf4 knockout mutants differ significantly in design strategy and outcome:

Complete knockout strategy (targeting entire ORF):

  • Vector design: Develop a chloroplast transformation vector with:

    • Left border flanking sequence: psaI along with nucleotides of accD

    • Right border flanking sequence: ycf10

    • Selection marker: aadA gene (aminoglycoside 3'-adenyltransferase) with gfp (FLARE-S cassette)

  • Transformation protocol:

    • Coat vector DNA on gold particles (0.6 μm)

    • Bombard leaf tissue using particle gun

    • Culture bombarded leaves on RMOP medium with 500 mg/L spectinomycin

    • Root antibiotic-resistant shoots on MS medium with 30 g/L sucrose

  • Homoplasmy confirmation:

    • Multiple rounds of selection on spectinomycin

    • PCR verification using primers flanking the deletion cassette

    • Southern blot analysis with BamHI restriction and hybridization

Partial knockout strategy (targeting specific domains):

  • Targeted mutagenesis:

    • Design constructs targeting specific portions (e.g., N-terminal 93 of 184 amino acids)

    • Maintain intact C-terminus (last 91 amino acids) which retains partial function

  • Site-directed mutagenesis:

    • Target specific conserved residues (e.g., R120, E179, E181)

    • Create substitutions with similarly charged amino acids or with small/no charged side chains (A or Q)

Key methodological considerations:

  • Complete knockout requires careful design of flanking sequences to ensure precise replacement

  • Multiple rounds of selection are crucial for achieving homoplasmy

  • Verification requires both PCR amplification and Southern blot analysis

  • Growth conditions must include carbon source (30 g/L sucrose) for complete knockout mutants

How can researchers effectively analyze protein-protein interactions of Ycf4 with other photosynthetic components?

Analysis of Ycf4's interactions with other photosynthetic components requires a multi-faceted approach:

Experimental methods:

  • Co-immunoprecipitation (Co-IP):

    • Use antibodies against Ycf4 to pull down associated proteins

    • Analyze precipitated complexes by mass spectrometry

    • Particularly useful for identifying novel interaction partners

  • Thylakoid membrane fractionation:

    • Isolate thylakoid membranes and treat with alkali or chaotropic agents to distinguish between:

      • Integral membrane proteins

      • Extrinsic membrane proteins (Ycf4 is extrinsic)

    • Subsequent gradient centrifugation to separate protein complexes

  • Bimolecular Fluorescence Complementation (BiFC):

    • Split fluorescent protein tags on Ycf4 and potential interacting partners

    • Monitor reconstitution of fluorescence in vivo when proteins interact

In silico interaction analysis:

The table below summarizes hydrogen bond interactions between different regions of Ycf4 and various photosynthetic components, revealing the critical role of the C-terminus in protein interactions:

Docked complexHydrogen bonds (full-length Ycf4)Hydrogen bonds (amino terminus)Hydrogen bonds (carboxyl terminus)
Photosystem I components
Ycf4+psaA3 (range: 2.85-3.07)3 (range: 2.84-2.93)5 (range: 2.74-3.02)
Ycf4+psaB7 (range: 2.58-3.22)5 (range: 2.75-2.89)12 (range: 2.61-3.20)
Ycf4+psaC7 (range: 2.62-2.93)1 (range: 2.50)8 (range: 2.62-3.19)
Ycf4+psaH7 (range: 2.57-3.01)4 (range: 2.73-3.05)17 (range: 2.57-3.26)
Other key components
Ycf4+rbcL13 (range: 2.56-3.15)8 (range: 2.75-3.31)17 (range: 2.54-2.98)
Ycf4+rbcS10 (range: 2.75-3.10)9 (range: 2.64-3.22)14 (range: 2.58-2.96)
Ycf4+atpB12 (range: 2.56-3.15)8 (range: 2.62-3.12)28 (range: 2.54-3.27)

Note: This data demonstrates that the carboxyl terminus forms significantly more hydrogen bonds with photosynthetic components than the amino terminus, explaining why partial N-terminal knockouts retain some function.

How can contradicting research findings about Ycf4 essentiality be reconciled through experimental design?

Contradicting findings on Ycf4 essentiality can be reconciled through careful experimental design considering these key factors:

1. Extent of gene deletion:

  • Complete deletion studies show Ycf4 is essential for photoautotrophic growth

  • Partial deletion studies (93 of 184 amino acids from N-terminus) suggest Ycf4 is non-essential

  • Reconciliation approach: Design experiments with precise domain-specific deletions to map functional regions

2. Species-specific differences:

  • In Chlamydomonas reinhardtii: Ycf4-deficient mutants cannot grow photoautotrophically

  • In Cyanobacterium synechocystis: Orf184 mutants grow normally like wild-type cells, but with altered pigment content

  • Reconciliation approach: Conduct comparative studies across species using identical knockout strategies

3. Growth conditions:

  • Heterotrophic vs. photoautotrophic conditions yield different results

  • Ycf4 knockout plants can survive with external carbon (30g/L sucrose) but not photoautotrophically

  • Reconciliation approach: Standardize growth protocols and test multiple conditions

4. Methodological design for consistent comparison:

I propose a comprehensive experimental framework to resolve contradictions:

  • Generate a series of mutants in multiple model species:

    • Complete gene deletions

    • N-terminal deletions (~93aa)

    • C-terminal deletions (~91aa)

    • Site-directed mutants of key residues (R120, E179, E181)

  • Evaluate each mutant under standardized conditions:

    • Photoautotrophic growth

    • Heterotrophic growth (various carbon concentrations)

    • Mixed trophic conditions

    • Standard and stress conditions

  • Analytical measurements:

    • Photosystem I activity and accumulation

    • Chloroplast structural analysis via TEM

    • Protein stability assays (e.g., chloramphenicol treatment)

    • Transcriptome analysis

    • Protein-protein interaction studies

This approach would enable direct comparison between studies and reconcile apparently contradictory findings by identifying specific conditions under which Ycf4 is essential versus dispensable.

What experimental designs best elucidate the role of conserved amino acid residues in Ycf4 function?

To elucidate the role of conserved amino acid residues in Ycf4 function, I recommend the following experimental design approach:

1. Site-directed mutagenesis targeting conserved residues:

Focus on highly conserved charged residues in the hydrophilic domain, such as:

  • R120 (positively charged)

  • E179 and E181 (negatively charged)

For each residue, create the following substitutions:

  • Replace with similarly charged amino acids (maintaining charge)

  • Replace with amino acids with small or no charged side chains (A or Q)

  • Conservative and non-conservative substitutions

2. Multi-level phenotypic characterization:

Analyze each mutant at multiple levels:

  • Protein accumulation/stability (Western blot analysis)

  • PSI complex assembly and function

  • Growth characteristics under various conditions

  • Chloroplast ultrastructure (TEM analysis)

3. Protein stability assays:

The chloramphenicol treatment approach is particularly informative:

  • Inhibit chloroplast-encoded protein synthesis with chloramphenicol

  • Monitor stability of Ycf4 over time (0-240 minutes)

  • Quantify protein levels via Western blot

  • Compare mutants to wild-type protein

4. Structure-function correlation:

Based on previous findings, a systematic analysis would include:

ResidueMutationExpected Effect on Ycf4Expected Effect on PSI
R120R120ADestabilization (reduced to ~10% after 240 min chloramphenicol)Normal PSI accumulation despite low Ycf4
R120R120QDestabilization (reduced to ~10% after 240 min chloramphenicol)Normal PSI accumulation despite low Ycf4
E179E179AReduced accumulation (~50% of wild-type)Normal PSI accumulation
E179E179QMinimal effect on stability/functionNormal PSI accumulation
E181E181AReduced accumulation (~30% of wild-type)Decreased PSI (~60% of wild-type)
E181E181QMinimal effect on stability/functionNormal PSI accumulation

This data reveals that:

  • R120 is critical for protein stability but not directly for function

  • E181 appears important for both stability and function

  • E179 affects stability but not function

  • Glutamine substitutions (maintaining polarity) are better tolerated than alanine substitutions

How can genomic approaches be integrated with functional studies to advance our understanding of Ycf4 evolution?

Integrating genomic approaches with functional studies provides powerful insights into Ycf4 evolution:

1. Comparative genomic analysis:

  • Chloroplast genome structure comparison:

    • Analyze boundary regions between LSC, IR, and SSC regions across different species

    • Compare gene organization surrounding ycf4 in different Brassica varieties and related species

    • Identify syntenic regions and genomic rearrangements

  • Evolutionary rate analysis:

    • Calculate dN/dS ratios to detect selection pressures on ycf4

    • Compare sequence conservation across evolutionary distances

    • Identify highly conserved domains that may be functionally critical

2. Phylogenomic reconstruction:

Phylogenetic analysis has revealed relationships among Brassica species based on chloroplast genomes:

  • Five B. oleracea subspecies cluster together

  • Kohlrabi chloroplast genome is closely related to B. oleracea var. botrytis

  • This information guides selection of appropriate comparative species

3. Functional validation of evolutionary insights:

  • Ancestral sequence reconstruction:

    • Infer ancestral sequences of Ycf4

    • Express these reconstructed proteins to test function

    • Map functional changes onto phylogenetic trees

  • Domain swapping experiments:

    • Exchange domains between Ycf4 proteins from different species

    • Test chimeric proteins for complementation in ycf4 knockout backgrounds

    • Identify functionally equivalent or divergent regions

4. Integration of structural and evolutionary data:

  • Use homology modeling to predict protein structures

  • Map conservation data onto structural models

  • Identify potential co-evolution between Ycf4 and interacting partners

5. Methodological approach for integrative analysis:

  • Select diverse species spanning evolutionary distances:

    • Model species (Arabidopsis thaliana)

    • Crop species (Brassica oleracea varieties)

    • More distant relatives (e.g., Bunias orientalis)

  • Analyze chloroplast genome structure:

    • Complete genome sequencing

    • Annotation of ycf4 and surrounding regions

    • Boundary analysis between genome regions

  • Perform comparative functional assays:

    • Standard growth conditions

    • Stress conditions

    • Quantitative photosynthetic measurements

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.