Recombinant Brassica rapa Apocytochrome f (petA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to sediment the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
petA; Cytochrome f
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
36-320
Protein Length
Full Length of Mature Protein
Species
Brassica rapa subsp. rapa (Turnip)
Target Names
petA
Target Protein Sequence
YPIFAQQNYENPREATGRIVCANCHLASKPVDIEVPQAVLPDTVFEAVVKIPYDMQLKQV LANGKKGALNVGAVLILPEGFELAPPDRISPEMKEKIGNLSFQNYRPNKKNILVIGPVPG QKYSEITFPILAPDPATNKDVHFLKYPIYVGGNRGRGQIYPDGSKSNNTVYNATAGGIIS KILRKEKGGYEITIVDASNERQVIDIIPRGLELLVSEGESIKLDQPLTSNPNVGGFGQGD AEIVLQDPLRVQGLLFFLGSVVLAQIFLVLKKKQFEKVQLSEMNF
Uniprot No.

Target Background

Function
Recombinant Brassica rapa Apocytochrome f (petA) is a component of the cytochrome b6-f complex. This complex facilitates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions.
Protein Families
Cytochrome f family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Single-pass membrane protein.

Q&A

What is Apocytochrome f (petA) and what is its function in Brassica rapa?

Apocytochrome f, encoded by the petA gene, is a critical component of the cytochrome b6f complex in the photosynthetic electron transport chain. In Brassica rapa, as in other photosynthetic organisms, it functions as an electron carrier in the thylakoid membrane, facilitating electron transfer between photosystem II and photosystem I during photosynthesis.

The mature protein (residues 36-320) contains a heme group and plays a crucial role in the proton gradient formation across the thylakoid membrane. Unlike many proteins in B. rapa that exist in multiple copies due to genome triplication events, petA is typically found as a single copy in the plastid genome .

What expression systems have been successfully used for recombinant Brassica rapa Apocytochrome f production?

Several expression systems have been documented for recombinant Brassica rapa protein production:

Expression SystemAdvantagesLimitationsExample Applications
E. coliHigh yield, rapid growth, simple geneticsLack of post-translational modifications, inclusion body formationStructural studies, antibody production
B. rapa hairy rootNative-like post-translational modifications, consistent glycosylation patternsSlower growth than bacterial systems, more complex extractionComplex glycoproteins like IDUA
Plant cell culturesProper folding of plant proteins, scalableLower yields than E. coli, longer production timeFunctional studies of photosynthetic proteins

For Apocytochrome f specifically, E. coli expression systems using His-tag purification have been shown to be effective for producing the soluble domain for biochemical studies .

What are the optimal conditions for expressing functional recombinant Apocytochrome f in bacterial systems?

For optimal expression in E. coli:

  • Expression vector selection:

    • pET series vectors with T7 promoter show high expression levels

    • Lower temperature induction (16-18°C) improves solubility

    • Co-expression with chaperones (GroEL/GroES) reduces aggregation

  • Culture conditions:

    • Growth in modified Terrific Broth supplemented with 5-aminolevulinic acid (0.5 mM) as heme precursor

    • Induction at OD600 = 0.6-0.8 with 0.1-0.5 mM IPTG

    • Extended expression time (16-24 hours) at lower temperatures

  • Cell lysis:

    • Gentle lysis methods to preserve protein structure

    • Buffer supplementation with glycerol (10%) and reducing agents

How does the genetic organization of petA in Brassica rapa compare to other Brassica species?

The Brassica genus exhibits interesting genomic characteristics, with B. rapa showing distinctive patterns:

SpeciesGenomepetA OrganizationNotable Features
B. rapaAA, n=10Single copy in plastid genomePart of conserved operon structure
B. napusAACC, n=19Two copies (one from each parent)Sequence highly conserved between subgenomes
B. oleraceaCC, n=9Single copyHigh sequence similarity to B. rapa
A. thalianan=5Single copyUsed as reference for comparative studies

What methodological approaches can be used to study interactions between recombinant Apocytochrome f and other components of the electron transport chain?

Several approaches have proven effective:

  • Surface Plasmon Resonance (SPR):

    • Immobilize purified recombinant Apocytochrome f on a sensor chip

    • Flow potential interaction partners over the surface

    • Measure real-time binding kinetics (kon and koff rates)

  • Co-immunoprecipitation with recombinant partners:

    • Express tagged versions of interacting proteins

    • Use anti-tag antibodies to precipitate complexes

    • Analyze by Western blotting or mass spectrometry

  • Reconstitution studies:

    • Incorporate purified Apocytochrome f into liposomes

    • Add purified interaction partners

    • Measure electron transfer rates using artificial electron donors/acceptors

  • FRET analysis with fluorescently labeled proteins:

    • Label Apocytochrome f and potential partners with compatible fluorophores

    • Monitor energy transfer as evidence of interaction

    • Quantify interaction distances and dynamics

How can recombinant Apocytochrome f be used to study the effects of environmental stress on photosynthetic machinery?

Recombinant Apocytochrome f provides a valuable tool for investigating stress responses:

  • Experimental design for temperature stress studies:

    • Expose recombinant protein to varying temperatures (4-50°C)

    • Measure structural changes using circular dichroism

    • Compare thermal stability of wild-type versus mutant variants

    • Correlate with whole-plant photosynthetic performance under stress

  • Methodology for oxidative stress analysis:

    • Treat recombinant Apocytochrome f with various ROS (H₂O₂, O₂⁻, ¹O₂)

    • Identify oxidation-sensitive residues by mass spectrometry

    • Create oxidation-resistant mutants through site-directed mutagenesis

    • Test functional consequences of oxidative modifications

Research in Brassica rapa has shown that environmental stresses affect gene expression patterns, including those involved in photosynthesis. The PAP proteins in B. rapa showed coordinated responses to water stress, suggesting complex regulatory networks in stress adaptation .

What are the common challenges in maintaining proper folding of recombinant Apocytochrome f and how can they be addressed?

Challenges and solutions for recombinant Apocytochrome f production:

ChallengeCauseSolution Methodology
Improper heme incorporationInsufficient heme availability or incorrect redox environmentSupplement growth media with 5-aminolevulinic acid (0.5 mM); maintain reducing environment with 1-5 mM β-mercaptoethanol
Protein aggregationHydrophobic transmembrane domainsExpress soluble domain only (residues 36-250); use detergents (0.1% DDM) for full-length protein
Incorrect disulfide formationOxidizing conditions in E. coli cytoplasmUse specialized E. coli strains (SHuffle, Origami); add glutathione redox buffer (2:1 GSH:GSSG)
Low yield of functional proteinToxicity to host cellsUse tightly regulated expression systems; lower induction temperature to 16°C; induce at higher cell density

What analytical methods are most effective for assessing the structural integrity and functional activity of purified recombinant Apocytochrome f?

Multiple complementary approaches should be employed:

  • Spectroscopic analysis:

    • UV-visible spectroscopy (characteristic peaks at ~420 nm and ~550 nm)

    • Circular dichroism to assess secondary structure content

    • Fluorescence spectroscopy to monitor tertiary structure

  • Functional assays:

    • Electron transfer activity using artificial donors/acceptors

    • Cytochrome c reduction assay (monitoring absorbance at 550 nm)

    • Reconstitution with other components of the cytochrome b6f complex

  • Structural characterization:

    • Size-exclusion chromatography to assess oligomeric state

    • Thermal shift assays to determine stability

    • Limited proteolysis to verify proper folding

  • Advanced biophysical techniques:

    • Differential scanning calorimetry

    • Hydrogen-deuterium exchange mass spectrometry

    • Surface-enhanced Raman spectroscopy for heme environment analysis

How can recombinant Apocytochrome f be utilized to study evolutionary relationships within the Brassica genus?

Recombinant Apocytochrome f offers multiple approaches for evolutionary studies:

  • Sequence-based comparative analysis:

    • Heterologous expression of Apocytochrome f from different Brassica species

    • Biochemical characterization of functional differences

    • Correlation with environmental adaptations of different species

  • Ancestral sequence reconstruction:

    • Express computationally predicted ancestral Apocytochrome f sequences

    • Compare biophysical properties with extant variants

    • Identify critical evolutionary transitions in function

Brassica genomic studies have revealed complex evolutionary histories. The analysis of Ka/Ks ratios in Brassica species showed that combinations within Brassica species had higher Ka/Ks ratios than combinations with Arabidopsis, suggesting different selective pressures within the Brassica genus .

What methodological approaches can link Apocytochrome f function to agronomically important traits in Brassica rapa?

Researchers can employ these approaches:

  • Association studies:

    • Sequence petA and related genes across diverse B. rapa accessions

    • Measure photosynthetic efficiency parameters

    • Correlate sequence variations with phenotypic differences

    • Validate using recombinant protein variants

  • Transgenic complementation:

    • Create variants with altered electron transfer properties

    • Transform into B. rapa using established protocols

    • Assess impacts on growth, yield, and stress tolerance

Research has demonstrated that Brassica rapa responds to environmental conditions through complex regulatory networks. For example, studies on PhyB showed its involvement in regulating resource allocation and biomass partitioning in response to CO₂ levels, which could be related to photosynthetic efficiency .

How does the structure-function relationship of Apocytochrome f contribute to understanding photosynthetic adaptation in Brassica crops?

Structure-function studies offer insights into adaptation mechanisms:

  • Domain swap experiments:

    • Create chimeric proteins between B. rapa and other species

    • Express and purify recombinant proteins

    • Determine which regions confer species-specific properties

  • Site-directed mutagenesis approach:

    • Identify residues under positive selection through comparative genomics

    • Create single and multiple mutations at these positions

    • Characterize effects on electron transfer kinetics and stability

  • Environmental response analysis:

    • Test recombinant protein function under varying pH, salt, and temperature conditions

    • Correlate with the natural growing environments of different Brassica species

    • Identify adaptations that may confer agricultural advantages

The selective pressure analysis in Brassica has revealed that genes under positive selection often relate to environmental adaptation and reproduction. Studying structure-function relationships in photosynthetic proteins like Apocytochrome f can provide insights into how these adaptations manifest at the molecular level .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.