Recombinant Breda virus 1 Hemagglutinin-esterase (HE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
HE; Hemagglutinin-esterase; HE protein; E3 glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
15-416
Protein Length
Full Length of Mature Protein
Species
Breda virus 1 (BRV-1)
Target Names
HE
Target Protein Sequence
ATPVTPYYGPGHITFDWCGFGDSRSDCTNPQSPMSLDIPQQLCPKFSSKSSSSMFLSLHW NNHSSFVSYDYFNCGVEKVFYEGVNFSPRKQYSCWDEGVDGWIELKTRFYTKLYQMATTS RCIKLIQLQAPSSLPTLQAGVCRTNKQLPDNPRLALLSDTVPTSVQFVLPGSSGTTICTK HLVPFCYLNHGCFTTGGSCLPFGVSYVSDSFYYGYYDATPQIGSTESHDYVCDYLFMEPG TYNASTVGKFLVYPTKSYCMDTMNITVPVQAVQSIWSEQYASDDAIGQACKAPYCIFYNK TTPYTVTNGSDANHGDDEVRMMMQGLLRNSSCISPQGSTPLALYSTEMIYEPNYGSCPQF YKLFDTSGNENIDVISSSYFVATWVLLVVVVILIFVIISFFC
Uniprot No.

Target Background

Function

Hemagglutinin-esterase (HE) is a structural protein forming short surface spikes on the Breda virus. It exhibits receptor-binding and receptor-destroying activities, mediating the de-O-acetylation of N-acetyl-9-di-O-acetylneuraminic acid—a likely receptor determinant on erythrocyte and susceptible cell surfaces. While it also hydrolyzes 5-N-acetyl-4-O-acetylneuraminic acid and N-acetyl-9-O-acetylneuraminic acid, it shows a preference for N-acetyl-9-di-O-acetylneuraminic acid. This receptor-destroying activity is crucial for viral release, preventing self-aggregation and ensuring efficient cell-to-cell spread of progeny virions. HE may function as a secondary attachment protein, complementing the primary spike protein in initiating infection. Although not strictly essential for viral infection in culture, its presence can influence pathogenicity. HE is a potential target for both humoral and cellular immune responses.

Database Links

KEGG: vg:3707767

Protein Families
Influenza type C/coronaviruses hemagglutinin-esterase family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Q&A

What is the genetic organization of the Breda virus HE gene?

The hemagglutinin-esterase (HE) gene of Breda virus 1 (BRV-1) is a 1.25 kb gene located between the genes encoding membrane (M) and nucleocapsid (N) proteins in the bovine torovirus genome . This novel gene encodes a class I membrane protein that displays approximately 30% sequence identity with the hemagglutinin-esterases of coronaviruses and influenza C viruses . The HE gene in BRV-1 has an identical nucleotide sequence to that of BRV-2, while the 3'-most 0.5 kb portion is also present in the equine torovirus isolate Berne virus (BEV) genome as an X pseudogene .

What are the structural characteristics of the Breda virus HE protein?

The Breda virus HE protein is a 65 kDa N-glycosylated protein with a cleavable N-terminal signal sequence of 14 residues . Computer analysis predicts that residues 393-415 form a potential transmembrane domain . The protein contains the F-G-D-S motif, which serves as the putative catalytic site responsible for acetylesterase activity, similar to influenza C virus and coronavirus acetylesterases . As a structural protein, HE forms short surface projections approximately 6 nm in length on the virion surface, which are distinct from the larger 17-20 nm spikes formed by other viral proteins .

How is the HE gene amplified and sequenced from torovirus samples?

The HE gene can be amplified from torovirus genomic RNA using long RT-PCR methods. Researchers have successfully employed the following approach:

  • Viral RNA extraction from sucrose-gradient purified virus preparations or directly from clinical specimens

  • RT reaction using virus-specific primers designed based on conserved regions

  • PCR amplification with specific cycling parameters: denaturation at 99°C for 35 seconds, annealing at 67°C for 30 seconds, and elongation at 68°C for 5 minutes for 35 cycles

  • Analysis of amplicons by electrophoresis on 1% agarose gels

  • Direct sequencing of the amplified products or cloning into appropriate vectors before sequencing

This methodology has been successfully applied to amplify the approximately 1.2-1.4 kb region containing the HE gene from both bovine (BRV) and human torovirus (HTV) samples .

What expression systems are used for recombinant production of Breda virus HE?

The Breda virus HE protein has been successfully expressed using several systems:

  • Baculovirus expression system: The HE genes of BRV-1 and HTV have been cloned and expressed in Sf9 insect cells using recombinant baculoviruses. The expressed proteins are cell-associated (not secreted) and can be purified using SDS-PAGE for further applications .

  • Mammalian cell expression: Heterologous expression of the BoTV HE gene has yielded functional 65 kDa N-glycosylated proteins displaying acetylesterase activity .

  • Virus vector-based expression: Recombinant coronaviruses (such as modified MHV strains) have been engineered to express torovirus HE proteins, providing insights into HE functionality in the context of viral infection .

What methodologies are employed for detecting Breda virus HE expression in experimental systems?

Several complementary techniques can be used to detect and characterize HE expression:

  • Immunoblotting/Western blotting: Using antisera raised against HE proteins or antibodies targeting tagged versions of HE. Typically performed following SDS-PAGE on 12% resolving gels and transfer to PVDF membranes .

  • Indirect immunofluorescence: Utilizing antisera against HE or antibodies targeting epitope tags (such as HA) incorporated into recombinant HE proteins. This approach allows visualization of the cellular localization of HE .

  • Enzymatic activity assay: The acetylesterase activity of HE can be detected using in situ pararosanilin staining with α-naphthyl acetate as a substrate. This colorimetric assay enables direct visualization of functional HE .

  • Immunoelectron microscopy: This technique provides formal evidence for HE as a structural protein and allows visualization of HE incorporation into virions .

  • Hemagglutination inhibition assays: These can be used to detect functional HE protein and assess the binding of antibodies to the hemagglutinin domain .

How can reverse genetics be applied to study Breda virus HE function?

Reverse genetics systems for toroviruses enable manipulation of the viral genome to study HE functionality:

  • BAC-based full-length infectious cDNA cloning: A reverse genetic system has been developed for BToV (Aichi strain) based on cloning a full-length genomic cDNA into a bacterial artificial chromosome (BAC) .

  • Generation of recombinant viruses with modified HE: This approach allows the creation of viruses expressing:

    • Wild-type functional HE (HE+)

    • Enzymatically inactive HE (HE0)

    • No HE protein (HE-)

  • Targeted RNA recombination: This method has been used to generate recombinant viruses with modified HE genes in coronavirus models .

  • Analysis of recombinant virus properties:

    • In vitro growth characteristics

    • Plaque morphology

    • Cellular localization of HE

    • Assessment of esterase activity

Table 1: Comparative analysis of recombinant viruses with different HE expression profiles

Virus TypeHE ExpressionEsterase ActivitySurface ProjectionsReceptor Binding
rBToV-HEfFull-length HEActivePresent (6 nm)Present
rBToV-HEsSoluble HEActiveAbsentSecreted
rBToV-HE0Mutant HEInactivePresentPresent
rBToV-HE-NoneNoneAbsentAbsent

What is the molecular basis for substrate specificity in Breda virus HE?

The substrate specificity of Breda virus HE is determined by specific structural features:

  • Arginine-Sia carboxylate interaction: A functionally conserved (but not structurally conserved) arginine-sialic acid carboxylate interaction is critical for binding and positioning glycosidically bound sialic acids in the catalytic pocket . This interaction is essential for efficient de-O-acetylation of sialic acids but is not required for catalysis itself nor does it affect substrate specificity .

  • Single-residue determinants: The distinct preference of porcine torovirus HE for 9-mono-O-acetylated over 7,9-di-O-acetylated sialic acids can be explained by a single-residue difference compared to HEs with more promiscuous specificity .

  • Co-evolution of esterase and lectin domains: Research suggests that the esterase and lectin pockets of HE proteins have co-evolved. The porcine torovirus HE receptor-binding site appears designed to use 9-mono-O-acetylated sialic acids while excluding di-O-acetylated forms, possibly representing an adaptation to replication in swine .

How does HE expression affect viral pathogenesis in experimental models?

Studies using recombinant coronaviruses expressing torovirus HE proteins have provided insights into HE's role in pathogenesis:

  • Impact on viral tropism: The expression of HE proteins can modify tissue tropism in some viral backgrounds, but effects appear to be strain-dependent .

  • Neurovirulence modulation: In murine models using MHV-JHM backbone viruses expressing HE, significant increases in neurovirulence were observed. Interestingly, this enhanced virulence occurred regardless of whether the expressed HE was enzymatically active or inactive .

  • Viral dissemination: Viruses expressing HE (either wild-type or enzymatically inactive) in combination with specific spike proteins showed more extensive dissemination in target tissues compared to HE-negative viruses .

  • Survival rates: In intracranial inoculation models, mice infected with recombinant viruses expressing HE (both active and inactive forms) showed significantly lower survival rates than those infected with HE-negative viruses .

What methodologies are employed to characterize the interaction between HE and sialic acid receptors?

Several approaches have been used to study HE-receptor interactions:

  • Crystal structure analysis: Crystal structures of porcine and bovine torovirus HEs in complex with receptor analogs have provided detailed insights into the molecular basis of receptor recognition .

  • Structure-guided biochemical analysis: This approach has revealed critical interactions in the esterase domain that are essential for binding and positioning of glycosidically bound sialic acids .

  • Site-directed mutagenesis: Specific amino acid substitutions can be introduced to assess their impact on receptor binding and substrate specificity.

  • Receptor depletion assays: Treatment of cells with specific sialidases or chemical modifications of sialic acids can help determine the specific receptor requirements for HE binding.

How can recombinant Breda virus HE be used for serological diagnostics?

Recombinant HE proteins have significant diagnostic applications:

  • Development of specific antisera: Purified recombinant HE proteins can be used to immunize animals (such as guinea pigs) to generate hyperimmune sera with high specificity for torovirus HE .

  • Immunoblot assays: Hyperimmune sera raised against recombinant HE proteins can detect a 65 kDa protein (corresponding to HE) in bovine torovirus (BTV) and human torovirus (HTV) positive samples .

  • Dot blot analysis: This method allows rapid screening of clinical specimens using HE-specific hyperimmune sera .

  • Cross-reactivity testing: Antisera raised against BRV-1 HE show cross-reactivity with HTV, and vice versa, indicating conserved epitopes between species variants .

  • Convalescent sera reactivity: Human convalescent sera and post-infection sera from gnotobiotic calves react with recombinant HE in immunoblot assays, confirming that HE is expressed during natural infection and represents a prominent antigen .

What methods are used to assess the enzymatic activity of recombinant HE proteins?

The acetylesterase activity of recombinant HE can be evaluated using several methods:

  • Colorimetric esterase assays: Using α-naphthyl acetate as a substrate, followed by pararosanilin staining to visualize enzyme activity .

  • Specific sialic acid substrate assays: Testing activity against defined O-acetylated sialic acid substrates to determine specificity for 7-O-acetyl, 9-O-acetyl, or 7,9-di-O-acetyl sialic acids .

  • Hemagglutination and hemadsorption assays: These can indirectly assess functional HE activity by measuring binding to red blood cells with appropriate sialic acid modifications.

  • Site-directed mutagenesis of the catalytic site: Comparison of wild-type HE with mutants containing substitutions in the F-G-D-S motif provides insight into the importance of specific residues for enzymatic activity .

What experimental design considerations are important when working with recombinant torovirus HE?

When designing experiments with recombinant Breda virus HE, researchers should consider:

  • Expression system selection: Different expression systems (baculovirus, mammalian, bacterial) may yield proteins with varying glycosylation patterns and enzymatic activities.

  • Purification strategy: Since HE proteins are typically cell-associated rather than secreted, appropriate cell lysis and purification methods must be employed .

  • Epitope tagging considerations: The addition of epitope tags (such as HA) may affect protein detection depending on the tag position. For example, HEf/HA (full-length HE with HA tag) may be poorly detected by some anti-HA antibodies despite good detection with anti-HE antisera .

  • Functional assay selection: Both the hemagglutinin and esterase activities should be assessed using complementary methods to fully characterize recombinant HE function.

  • Storage and stability: Proper conditions for maintaining enzymatic activity during storage should be established and validated.

What are the emerging approaches for studying structure-function relationships in Breda virus HE?

Several cutting-edge approaches show promise for deeper understanding of HE:

  • Cryo-electron microscopy: This technique can provide high-resolution structural information about HE in its native conformation on the virion surface.

  • Single-molecule studies: These approaches can elucidate the kinetics of HE-receptor interactions and provide insights into the dynamic aspects of binding and catalysis.

  • Glycan microarray technology: This platform enables comprehensive analysis of HE binding preferences across diverse sialic acid modifications.

  • CRISPR/Cas9-mediated genetic manipulation: This allows for precise engineering of host cells to modify sialic acid display and assess the impact on HE binding and viral infection.

  • Comparative genomics and phylogenetics: Analysis of HE sequences across diverse torovirus isolates can reveal evolutionary patterns and species-specific adaptations in receptor recognition.

How might recombinant Breda virus HE contribute to understanding cross-species transmission of toroviruses?

The HE protein holds significant potential for elucidating torovirus host range:

  • Comparative analysis of HE specificity: The differences in substrate preferences between bovine, porcine, and human torovirus HE proteins may reflect adaptations to species-specific sialic acid distributions .

  • HE as a determinant of host range: Studies comparing the receptor binding preferences of HE proteins from different host species can identify molecular barriers to cross-species transmission.

  • Modeling HE evolution: The HE gene serves as "a showpiece example of modular evolution" , providing insights into how viruses acquire and adapt novel functions through gene capture and modification.

  • Recombination analysis: The presence of HE in multiple virus families (toroviruses, coronaviruses, and orthomyxoviruses) suggests complex evolutionary relationships that warrant further investigation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.