Recombinant Breda virus 1 Membrane protein (M)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
M; Membrane protein; M protein; E1 glycoprotein; Matrix glycoprotein; Membrane glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-233
Protein Length
full length protein
Species
Breda virus 1 (BRV-1)
Target Names
M
Target Protein Sequence
MFETNYWPFPDQAPNPFNAQVEQLSATENVYIFLTTLFGILQLVYVIFKLLCTMFPALHW SPIWRGLENFWLFLSLASLAIAYWWLPSMTFTGYWALTIIATILGLIMLIMMSVKFVSFV KLFYRTGSFAIAIRGPIVLVALDVTIKLHCTPFAILVKEVGNIFYLSEYCNKPLTAAQVA ALRICVGGQWFAYTRSTTTSAAKVAAANSTAKYHLFVLQGVAEYTQLSSVKFE
Uniprot No.

Target Background

Function

A viral envelope component crucial for virus morphogenesis and assembly through interactions with other viral proteins.

Database Links

KEGG: vg:3707769

Protein Families
Torovirinae M protein family
Subcellular Location
Virion membrane; Multi-pass membrane protein. Host Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Breda virus and how is it classified taxonomically?

Breda virus (BRV) is an established etiological agent of diarrhea in cattle, classified as a member of the genus torovirus. It exists as two separate serotypes, BRV-1 and BRV-2, with distinct antigenic properties but significant structural similarities. The virus belongs to the proposed family Toroviridae, with Berne virus serving as the prototype for this viral grouping .

Research characterization typically involves isolating viral samples from feces of experimentally infected gnotobiotic calves, followed by purification through ultracentrifugation and gradient separation techniques. When studying the taxonomy of these viruses, researchers should note that BRV-1 shares approximately 80% nucleotide sequence identity with Berne virus in the 7.5 kb region from the 3′ end of the genome that contains the genes for structural proteins .

How does the Breda virus 1 M protein compare with other torovirus structural proteins?

Within the Breda virus 1 genome architecture, the M protein gene exists alongside other structural protein genes including the peplomer (S), nucleocapsid (N), and a novel 1.2 kb hemagglutinin-esterase (HE) gene located between the M and N genes . Each of these proteins serves distinct structural and functional roles in the viral particle.

When conducting comparative protein analysis between different toroviruses, researchers should note that while the M protein shows considerable sequence conservation, the surface proteins demonstrate greater variability. Immunological studies have shown that mouse immune serum raised against Breda-2 virus recognized the polypeptides of the homologous virus and the two highest molecular weight proteins of Breda-1 virus in radioimmune precipitation assays . This partial cross-reactivity provides important insights for researchers developing diagnostic tools or investigating immune responses to torovirus infections.

What are the standard methods for expressing recombinant Breda virus 1 M protein?

To successfully express recombinant Breda virus 1 M protein, researchers can adapt protocols that have been used for other viral proteins from the same virus. For example, the nucleocapsid (N) gene of BRV-1 has been successfully expressed in Escherichia coli expression systems after RT-PCR amplification and cloning . A similar approach can be applied to the M protein gene.

The methodological workflow typically involves:

  • Primer design based on the known sequence of the BRV-1 genome or related toroviruses

  • RT-PCR amplification of the M gene using high-fidelity polymerases

  • Cloning into a suitable expression vector with appropriate promoters and tags

  • Transformation into expression-optimized E. coli strains

  • Induction of protein expression under controlled conditions

  • Protein purification through methods such as SDS-PAGE or affinity chromatography

When designing the expression system, researchers should consider including purification tags and optimizing codon usage for the expression host to improve yield and solubility of the recombinant protein .

What is the optimal RT-PCR protocol for amplifying the Breda virus 1 M gene region?

For successful amplification of the Breda virus 1 M gene, researchers should implement a specialized long RT-PCR protocol similar to that used for amplifying other regions of the BRV-1 genome. Based on established methodologies, the following optimized protocol is recommended:

First, design primers that flank the M gene region, potentially utilizing known sequences from related toroviruses such as Berne virus if specific BRV-1 sequences are not available. For reverse transcription, prepare a 20 μl RT mixture containing 4 μl of 5× 1st Strand Synthesis Buffer, 0.5 μl RNasin (20–40 U/μl), 1 μl of 100 mM dithiothreitol, 1 μl of 10 mM dNTPs, 2.5 μl of a 10 μM primer stock solution, and 1 μl (200U) of Superscript II reverse transcriptase .

The reaction mixture should be incubated at 42°C for 1 hour, followed by addition of 1 μl of RNase H (1–4 U/μl) and 1 μl of RNase T1 (900–3000 U/μl), with further incubation at 37°C for 20 minutes to remove template RNA . For the PCR amplification step, use a high-fidelity polymerase mix designed for long amplicons, with cycling conditions consisting of denaturation at 99°C for 35 seconds, annealing at 67°C for 30 seconds, and elongation at 68°C for 8 minutes during the first 25 cycles, followed by extended elongation steps of 68°C for 12 minutes during the final 10 cycles .

To minimize DNA damage during visualization, electrophorese the amplicons on a 0.7% agarose gel and view under UV light with appropriate shielding (such as illuminating through two Plexiglas trays) to prevent photo nicking .

How can researchers effectively purify Breda virus particles for M protein analysis?

Effective purification of Breda virus particles is essential for detailed analysis of the M protein and other structural components. A proven two-step purification method involves first pelleting the virus by ultracentrifugation, followed by sequential isokinetic and isopyknic sucrose gradient centrifugation .

The detailed methodology involves:

  • Collection of virus-containing samples (typically from feces of experimentally infected animals)

  • Initial clarification by low-speed centrifugation to remove large debris

  • Ultracentrifugation at high speeds (typically >100,000 × g) to pellet viral particles

  • Resuspension of the viral pellet in a suitable buffer

  • Layering the suspension on an isokinetic sucrose gradient

  • Centrifugation to separate viral particles based on their sedimentation properties

  • Collection of the virus-containing fractions

  • Further purification on an isopyknic sucrose gradient to separate based on buoyant density

  • Final collection and concentration of purified virus

When working with Breda virus 1, researchers should note that proper storage conditions are critical for maintaining virus integrity. Studies have shown that prolonged storage at 4°C can lead to heterogeneous sedimentation behavior (480 to 520 Svedberg units) and density (1.18 to 1.21 g/ml), indicative of poor preservation . Therefore, immediate processing or appropriate preservation methods are recommended for obtaining high-quality purified virus.

What approaches can be used to study the role of M protein in Breda virus 1 assembly?

Investigating the role of the M protein in Breda virus 1 assembly requires sophisticated molecular and cellular techniques. Based on recent advances in studying coronavirus assembly, several methodological approaches can be adapted for BRV-1 M protein research:

  • Cryo-electron microscopy analysis: This technique can reveal the structural conformation of the M protein within the viral envelope and how it interacts with other structural proteins. Recent research on coronavirus M proteins has demonstrated that these proteins can exist in different conformational states, with transitions between these states being critical for viral assembly .

  • Mutagenesis studies: Systematic introduction of mutations in the M protein gene followed by analysis of their effects on viral assembly can identify critical functional domains. Researchers should design mutations targeting potential interaction sites with other viral proteins or membrane components.

  • Protein-protein interaction assays: Co-immunoprecipitation, yeast two-hybrid systems, or proximity ligation assays can be employed to study interactions between the M protein and other viral components such as the S, N, or HE proteins.

  • Inhibitor screening: Development of small molecule libraries targeting the M protein can help identify compounds that disrupt viral assembly. The recent discovery of CIM-834, which targets the coronavirus M protein and blocks viral assembly by stabilizing a specific conformational state, provides a model for this approach .

  • Transmission electron microscopy: This technique can visualize virion assembly in infected cells under various experimental conditions, including the presence of potential assembly inhibitors or after introduction of M protein mutations .

When conducting these studies, researchers should consider the complementary roles of all structural proteins in the assembly process and design experiments that can distinguish direct effects on the M protein from indirect effects mediated through other viral components.

How can recombinant Breda virus 1 M protein be used in serological diagnostics?

Recombinant Breda virus 1 M protein offers significant potential for developing serological diagnostic assays for torovirus infections. To implement this approach, researchers should first establish an efficient expression and purification system for the M protein, similar to the methods described for the N protein .

The methodological workflow for developing M protein-based serological assays includes:

  • Expression of recombinant M protein in a suitable system (e.g., E. coli)

  • Purification of the expressed protein using SDS-PAGE or affinity chromatography

  • Validation of protein identity and integrity through Western blotting with specific antibodies

  • Development of immunoassay formats such as ELISA, dot blot, or immunochromatographic tests

  • Optimization of assay conditions including protein concentration, buffer composition, and incubation times

  • Validation using known positive and negative sera from experimental infections or field samples

Studies with the BRV-1 N protein have demonstrated that recombinant viral proteins can be used effectively in dot blot assays to detect both bovine and human toroviruses from fecal specimens . A similar approach with the M protein could provide complementary diagnostic capabilities, potentially with different sensitivity or specificity profiles compared to N protein-based assays.

What are the cross-reactivity patterns of antibodies against Breda virus 1 M protein?

Understanding the cross-reactivity patterns of antibodies against the Breda virus 1 M protein is essential for designing specific diagnostic tests and for elucidating the antigenic relationships between different toroviruses. While specific data on M protein cross-reactivity is limited, insights can be drawn from studies on other structural proteins and from general torovirus serology.

Research has shown that mouse immune serum raised against Breda-2 virus recognized not only the homologous virus proteins but also the two highest molecular weight proteins of Breda-1 virus in radioimmune precipitation assays . This suggests the existence of shared epitopes between the serotypes, which may include epitopes on the M protein.

Furthermore, the same anti-Breda-2 serum inhibited hemagglutination of the heterologous serotype to a low but significant degree and efficiently neutralized the infectivity of Berne virus . These observations indicate that there are conserved antigenic determinants across different torovirus species and serotypes.

For researchers investigating cross-reactivity, it is recommended to:

  • Generate specific antisera against recombinant M protein

  • Test reactivity against whole virus preparations of different torovirus serotypes and species

  • Conduct competitive binding assays to map epitope conservation

  • Perform sequence analysis to identify conserved regions that might explain observed cross-reactivity patterns

Such cross-reactivity studies can inform the development of broadly reactive or highly specific diagnostic tools, depending on the research or clinical requirements.

How does the Breda virus 1 M protein structure compare with other viral membrane proteins?

Although detailed structural information specifically for the Breda virus 1 M protein is limited in the available literature, comparative analysis with other viral membrane proteins, particularly those from related viruses, can provide valuable insights for researchers.

The coronavirus M protein, which serves as the main organizer of coronavirus assembly, offers a relevant comparative model . Recent structural studies using single-particle cryo-electron microscopy have revealed that coronavirus M proteins can exist in different conformational states (short and long forms), with the transition between these states being critical for successful particle assembly .

When investigating the structure of BRV-1 M protein, researchers should consider:

  • Secondary structure prediction based on amino acid sequence

  • Transmembrane domain analysis to identify membrane-spanning regions

  • Comparative modeling using coronavirus M proteins as templates

  • Investigation of potential conformational states similar to those observed in coronavirus M proteins

  • Analysis of potential interaction sites with other viral structural proteins

Additionally, researchers should note that while torovirus and coronavirus proteins may have limited sequence identity, functional and structural similarities can exist, as observed with the S protein where both virus families contain similar motifs such as heptad repeats despite lack of sequence homology .

What experimental approaches can determine the topology of Breda virus 1 M protein in membranes?

Determining the membrane topology of the Breda virus 1 M protein requires specialized techniques that can distinguish between cytoplasmic, transmembrane, and extracellular/luminal domains. Several complementary methodological approaches can be employed:

  • Protease protection assays: Express the recombinant M protein in membrane systems (microsomes or liposomes) and treat with proteases such as trypsin or proteinase K. Protected fragments represent transmembrane or luminal domains, while digested regions are exposed on the cytoplasmic face.

  • Glycosylation mapping: Introduce consensus N-glycosylation sites at various positions in the M protein sequence. Since glycosylation occurs in the lumen of the endoplasmic reticulum, only sites in luminal domains will be glycosylated, providing information on protein orientation.

  • Fluorescence quenching assays: Label specific residues with fluorescent probes and measure accessibility to membrane-impermeable quenchers to determine which regions are exposed to the aqueous environment.

  • Immunofluorescence microscopy: Create epitope-tagged versions of the M protein with tags at different positions, then use selective permeabilization conditions combined with antibody labeling to determine which epitopes are accessible from which side of the membrane.

  • Cysteine accessibility methods: Introduce cysteine residues at various positions and test their accessibility to membrane-permeable and -impermeable sulfhydryl reagents to map the topology.

Each of these approaches has specific advantages and limitations, so a combination of methods is recommended for generating a comprehensive topological map of the Breda virus 1 M protein in membranes.

How can researchers investigate potential inhibitors of Breda virus 1 M protein function?

Developing inhibitors targeting the Breda virus 1 M protein represents an advanced research direction with potential therapeutic implications. Recent work with coronavirus M proteins provides a methodological framework that can be adapted for BRV-1 research .

A comprehensive approach to M protein inhibitor discovery includes:

  • High-throughput phenotypic screening: Test compound libraries for antiviral activity against BRV-1 in appropriate cell culture systems, followed by target identification to confirm M protein-specific inhibitors.

  • Structure-based drug design: If structural information becomes available (through crystallography or cryo-EM), conduct in silico screening to identify compounds that may bind to critical functional sites on the M protein.

  • Conformational stabilization strategy: Following the example of CIM-834, which inhibits coronavirus assembly by stabilizing the M protein in its short form and preventing the conformational switch required for assembly , investigate compounds that might similarly lock the BRV-1 M protein in non-functional conformations.

  • Transmission electron microscopy validation: Confirm the impact of potential inhibitors on virion assembly through direct visualization of infected cells in the presence and absence of candidate compounds .

  • Animal model testing: For promising candidates, evaluate efficacy in appropriate animal models of BRV-1 infection, monitoring viral titers and transmission as key endpoints .

When implementing this research strategy, investigators should carefully consider the specificity of the compounds for the M protein versus other viral or cellular targets, and assess potential cytotoxicity alongside antiviral activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.