Recombinant Breda virus 2 Hemagglutinin-esterase (HE)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
HE; Hemagglutinin-esterase; HE protein; E3 glycoprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
15-416
Protein Length
Full Length of Mature Protein
Species
Breda virus 2 (BRV-2)
Target Names
HE
Target Protein Sequence
ATPVTPYYGPGHITFDWCGFGDSRSDCTNPQSPMSLDIPQQLCPKFSSKSSSSMFLSLHW NNHSSFVSYDYFNCGVEKVFYEGVNFSPRKQYSCWDEGVDGWIELKTRFYTKLYQMATTS RCIKLIQLQAPSSLPTLQAGVCRTNKQLPDNPRLALLSDTVPTSVQFVLPGSSGTTICTK HLVPFCYLNHGCFTTGGSCLPFGVSYVSDSFYYGYYDATPQIGSTESHDYVCDYLFMEPG TYNASTVGKFLVYPTKSYCMDTMNITVPVQAVQSIWSEQYASDDAIGQACKAPYCIFYNK TTPYTVTNGSDANHGDDEVRMMMQGLLRNSSCISPQGSTPLALYSTEMIYEPNYGSCPQF YKLFDTSGNENIDVISSSYFVATWVLLVVVVILIFVIISFFC
Uniprot No.

Target Background

Function

Hemagglutinin-esterase (HE) is a structural protein forming short surface spikes on the Breda virus. It possesses receptor-binding and receptor-destroying activities, mediating the de-O-acetylation of N-acetyl-9-di-O-acetylneuraminic acid, a likely receptor determinant on erythrocyte and susceptible cell surfaces. While it also hydrolyzes 5-N-acetyl-4-O-acetylneuraminic acid and N-acetyl-9-O-acetylneuraminic acid, it shows a substrate preference for N-acetyl-9-di-O-acetylneuraminic acid. This receptor-destroying activity is crucial for viral release, potentially preventing self-aggregation and ensuring efficient cell-to-cell spread of progeny virions. HE may function as a secondary viral attachment protein, complementing the primary spike protein in initiating infection. Although not strictly essential for viral infection in culture, its presence can influence pathogenicity. HE is a potential target for both humoral and cellular immune responses.

Protein Families
Influenza type C/coronaviruses hemagglutinin-esterase family
Subcellular Location
Virion membrane; Single-pass type I membrane protein. Host cell membrane; Single-pass type I membrane protein.

Q&A

What is the molecular structure of Breda virus 2 Hemagglutinin-esterase?

Breda virus 2 (BRV-2) Hemagglutinin-esterase is a class I membrane protein of approximately 65 kDa when glycosylated. The HE protein is encoded by a 1.2-1.25 kb gene located between the genes for membrane and nucleocapsid proteins in the bovine torovirus genome . Structurally, HE displays approximately 30% sequence identity with hemagglutinin-esterases of coronaviruses and influenza C viruses . The protein forms short surface projections (averaging 6 nm in length) on the virion surface, which are distinct from the larger 17-20 nm spikes composed of other viral proteins . When expressed in heterologous systems, the protein retains its N-glycosylation and acetylesterase activity, confirming its functional integrity .

How does BRV-2 HE compare to HE proteins from other toroviruses?

The HE gene of human torovirus (HTV) shows approximately 85% sequence identity at the nucleotide level with the HE genes of both BRV-1 and BRV-2 . Additionally, it shares 89% identity with the X pseudogene sequence of Berne virus (BEV) . Despite BEV being a torovirus prototype (equine origin), it lacks the full-length HE gene and only contains the 3'-most 0.5 kb of this gene in its genome . This comparative genomic analysis suggests evolutionary differences among toroviruses from different host species, with bovine and human toroviruses retaining functional HE genes while the equine torovirus has only a partial, non-functional HE sequence .

What functional activities does the BRV-2 HE protein demonstrate?

The BRV-2 HE protein demonstrates dual functionality typical of hemagglutinin-esterase proteins:

  • Acetylesterase activity: When the protein is expressed in heterologous systems, it displays acetylesterase activity that can be detected through α-NA esterase assays . This enzymatic function is believed to facilitate viral detachment from host cell receptors.

  • Hemagglutination activity: Though less extensively characterized in the provided research, HE proteins typically possess hemagglutination activity allowing for binding to sialic acid-containing receptors on host cells .

Both activities remain intact when the full-length protein is expressed recombinantly, and the acetylesterase activity specifically serves as a useful marker to track functional integrity during experimental manipulations .

What are the optimal systems for recombinant expression of BRV-2 HE?

Based on the research evidence, two primary expression systems have been successfully employed for BRV-2 HE:

  • Baculovirus Expression System: This has been effectively used to express the 1.25 kb HE gene of both BRV-1 and human torovirus (HTV). The expressed proteins were purified using sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and produced functional 65 kDa proteins that retained their immunoreactivity . The baculovirus system in Sf9 cells allows for proper post-translational modifications, particularly glycosylation, which is essential for HE functionality.

  • Reverse Genetics System with BAC-based Cloning: A bacterial artificial chromosome (BAC)-based reverse genetics system has been developed for bovine torovirus (BToV) that enables manipulation of the viral genome, including the HE gene. This system allowed the creation of recombinant viruses with different HE variants: full-length HE (HEf), HA-tagged HEf, and soluble HE (HEs) . This approach permits studying the HE protein in the context of viral replication and provides a powerful tool for functional characterization.

For detection and characterization, immunoblotting using specific antisera or antibodies against HA tags (in tagged constructs) has proven effective, alongside α-NA esterase assays to confirm functional activity .

What methodological approaches are effective for detecting HE expression in experimental systems?

Several complementary methodological approaches have proven effective for detecting and characterizing expressed BRV-2 HE:

  • Immunoblotting: Proteins separated by SDS-PAGE can be detected using:

    • Hyperimmune sera prepared in guinea pigs against purified HE proteins

    • Anti-HA antibodies for HA-tagged constructs (both rabbit polyclonal and mouse monoclonal 12CA5)

    • Convalescent sera from infected animals or humans

  • Functional Assays:

    • α-NA esterase activity assay to confirm enzymatic function of the expressed protein

    • Hemagglutination inhibition tests to assess binding activity

  • Microscopy Techniques:

    • Immunofluorescence using specific antisera to localize the protein in infected or transfected cells

    • Immunoelectron microscopy (IEM) to visualize HE on viral particles

    • Confocal laser scanning microscopy for co-localization studies

  • Dot Immunoblot Analysis:

    • Rapid screening of clinical specimens using expressed HE proteins as detection reagents

These techniques collectively provide comprehensive characterization of the expressed protein both structurally and functionally.

How stable is the HE gene during viral passage in cell culture?

The stability of the HE gene during viral passage is variable and appears to depend on specific viral clones and experimental conditions. Research has demonstrated that:

  • General Trend: Wild-type bovine torovirus (BToV) isolates from clinical samples typically possess full-length HE genes (HEf), but cell-adapted viruses usually lose this full-length form due to the introduction of stop codons. A common mutation observed is CAG (Q) → TAG (stop) at nucleotide position 481, resulting in a truncated soluble HE protein of approximately 160 amino acids in length (HEs) .

  • Clone-Specific Variability: When recombinant BToVs with full-length HE genes were serially passaged up to 20 times:

    • Some clones (e.g., rHEf No.2 and two rHEf/HA clones) retained acetylesterase activity until passage 19

    • Other clones (e.g., rHEf No.1) showed gradual loss of activity during passages

  • Genetic Changes During Passage:

    • rHEf No.1 without esterase activity at passage 19 showed a one-base deletion at nucleotide T19, causing a frameshift that resulted in a 17-amino acid short peptide

    • rHEf No.2 with esterase activity retained the full-length HE gene, with one clone showing a T321I substitution

    • rHEf/HA No.2 showed more complex patterns with either retention of full-length (with D247E substitution in one) or large deletions (nt 278-878) in others

This variability suggests that while the HE gene is generally dispensable for viral replication in cell culture, certain viral genetic backgrounds may better tolerate and maintain the full-length gene over multiple passages.

What evidence supports the theory of modular evolution for the HE gene?

The HE gene provides compelling evidence for modular evolution across different virus genera based on several observations:

  • Cross-Genus Presence: The HE gene has been identified in three different virus genera—toroviruses (e.g., BRV), coronaviruses, and influenza C viruses—with approximately 30% sequence identity maintained across these evolutionarily distant groups .

  • Differential Presence Within Genera: Even within the torovirus genus, there are notable differences:

    • Bovine torovirus (BToV) and human torovirus (HTV) possess the complete HE gene

    • Equine torovirus (Berne virus, BEV) contains only the 3'-most 0.5 kb portion of this gene

  • Gene Position Flexibility: The HE gene occupies different genomic positions in various viruses, suggesting it has been acquired and repositioned during evolutionary history rather than being inherited from a common ancestor .

  • Functional Conservation: Despite sequence divergence, the acetylesterase activity remains conserved across different viral HE proteins, suggesting functional constraints on this module even after horizontal transfer events .

This evidence collectively supports the notion that the HE gene represents a functional module that has been exchanged between viral lineages through recombination events, making it a "showpiece example of modular evolution" as noted in the literature .

How can reverse genetics be applied to study BRV-2 HE function and modifications?

Reverse genetics provides powerful tools for studying BRV-2 HE through the following methodological approaches:

These approaches allow researchers to investigate the role of HE in viral tropism, pathogenesis, and host range, as well as to develop potential vaccine candidates or diagnostic tools based on the HE protein.

What immunological methods are most sensitive for detecting recombinant HE in diagnostic applications?

Several immunological methods have demonstrated high sensitivity for detecting recombinant HE, with varying applications:

  • Immunoblot Analysis:

    • Western blotting using hyperimmune sera against expressed HE proteins can detect the 65 kDa HE protein in both viral preparations and clinical specimens

    • Sensitivity can be enhanced using chemiluminescent detection methods

  • Dot Immunoblot Analysis:

    • Rapid screening method for clinical specimens

    • Can detect viral antigens directly in fecal samples from infected humans and animals

    • Particularly useful for field diagnostics and large-scale screening

  • Immunoelectron Microscopy (IEM):

    • Allows direct visualization of viral particles aggregated by hyperimmune sera

    • Provides dual confirmation of both morphological identification and immunological reactivity

    • Especially valuable for distinguishing toroviruses from other enteric viruses

  • Enzyme-Linked Immunosorbent Assays (ELISA):

    • Though not explicitly detailed in the search results, ELISA systems using recombinant HE as capture antigen have been developed

    • References indicate this approach has been used in serological studies

For optimal sensitivity in diagnostic applications, a combination of these methods is recommended, with dot immunoblot for initial screening followed by immunoblot or IEM for confirmation.

What biological significance might explain the selective pressure for HE gene inactivation during cell culture adaptation?

The consistent observation that BToV HE genes tend to be inactivated during cell culture adaptation suggests specific selective pressures at work:

  • Metabolic Burden Hypothesis: Expression of the full-length HE protein may impose a metabolic burden on viral replication in cell culture systems without providing compensatory benefits. Since the HE protein is a 65 kDa glycoprotein requiring substantial cellular resources for synthesis and post-translational modification, viruses that eliminate this expense may replicate more efficiently in vitro .

  • Receptor Binding Interference: In natural infections, HE likely plays a role in tissue tropism and host range through specific receptor interactions. In cell culture with homogeneous cell populations, these functions may be redundant or even interfere with optimal viral entry and release mediated by other viral proteins. Research observations suggest "HE protein is dispensable for virus replication in cells and may have a negative effect on it" .

  • Immune Evasion Irrelevance: In natural hosts, HE may contribute to immune evasion strategies, but this selective pressure is absent in cell culture systems.

  • Compensatory Evolution: The retention of full-length HE in some recombinant virus clones over 20 passages suggests that compensatory mutations elsewhere in the viral genome might mitigate the fitness costs of maintaining HE expression .

Understanding these selective pressures has important implications for vaccine development and in vitro studies of viral pathogenesis, as cell-adapted viruses may not accurately represent the viruses circulating in natural hosts.

How do BRV-2 recombinant viruses with different HE variants (HEf versus HEs) compare in replication kinetics and cytopathic effects?

The comparison between BRV-2 recombinant viruses with different HE variants reveals several important distinctions:

  • Plaque Morphology and CPE: Recombinant BToVs with full-length HE (rHEf), HA-tagged full-length HE (rHEf/HA), and soluble HE (rHEs) displayed "no significant differences in plaque morphology and CPEs in HRT18 cells compared to parental wtBToV and rBToV (rHEs)" . This suggests that the presence or absence of functional HE does not substantially impact the basic cytopathic characteristics of the virus in this cell line.

  • Protein Expression Patterns:

    • All variants showed similar expression of M and N proteins, indicating that core viral functions remain intact

    • HE proteins and α-NA esterase activity were detected only in cells infected with rHEf and rHEf/HA, confirming functional expression of the full-length proteins

    • Detection of HA-tagged proteins varied depending on the antibodies used, with HEs/HA being more readily detected than HEf/HA using most anti-HA antibodies

  • Stability During Passage:

    • Different clones showed variable stability of the HE gene during serial passage

    • Some clones maintained full-length HE and esterase activity through 19 passages

    • Others showed progressive loss of activity or acquired mutations

These observations suggest that while HE variants may not significantly impact basic viral replication parameters in cell culture, they might influence long-term evolutionary trajectories and potentially affect important aspects of virus-host interactions not captured in standard cell culture systems.

What experimental approaches can distinguish between structural and non-structural roles of HE in torovirus biology?

To definitively distinguish between structural and non-structural roles of HE in torovirus biology, several complementary experimental approaches can be employed:

  • Viral Particle Analysis:

    • Purification of viral particles through sucrose gradient centrifugation followed by immunoblotting for the HE protein provides evidence for structural incorporation

    • Immunoelectron microscopy using anti-HE antibodies can directly visualize HE on viral surfaces

    • These methods have confirmed that HE forms the shorter 6 nm surface projections on bovine torovirus particles, distinct from the larger 17-20 nm spikes

  • Density Gradient Analysis:

    • Comparing the density profiles of wild-type viruses versus HE-deficient mutants can reveal changes in particle composition

    • Radioiodination of purified virions followed by immunoprecipitation with anti-HE antibodies has been used to confirm HE as a structural component

  • Functional Complementation:

    • Trans-complementation experiments where HE is provided in trans (from a separate expression vector) to HE-deficient viruses can help determine if HE needs to be incorporated into virions for function

    • Assessment of whether complementation restores specific phenotypes can distinguish between structural and accessory roles

  • Timing of Expression Analysis:

    • Time-course studies examining HE expression relative to structural versus non-structural viral proteins

    • Pulse-chase experiments to track the fate of newly synthesized HE protein

  • Domain Mutation Studies:

    • Targeted mutations affecting the transmembrane anchor versus the functional domains can separate structural incorporation from enzymatic activity

    • Creation of chimeric proteins where HE domains are swapped with known structural or non-structural viral proteins

The evidence from existing research strongly supports HE as a true structural protein in bovine torovirus, with both immunological detection in purified virions and direct visualization by electron microscopy confirming its incorporation into the viral particle .

How do bovine and human torovirus HE proteins compare functionally and antigenically?

Bovine and human torovirus HE proteins show high conservation but with notable differences:

  • Sequence Homology: Human torovirus (HTV) HE shares 85% sequence identity at the nucleotide level with both BRV-1 and BRV-2 HE genes . This high conservation suggests similar functional properties.

  • Antigenic Cross-Reactivity:

    • Hyperimmune sera prepared against either BRV-1 or HTV HE proteins show cross-reactivity with both bovine torovirus (BTV) and human torovirus (HTV) antigens

    • In immunoblot analyses, these sera specifically react with a 65 kDa protein corresponding to HE in both BTV and HTV samples

    • Both types of hyperimmune sera aggregate torovirus particles from both species in immunoelectron microscopy studies

  • Immunological Recognition in Natural Infections:

    • Human convalescent sera from patients with HTV infections recognize the expressed 65 kDa BRV HE protein

    • Similarly, post-infection sera from gnotobiotic calves infected with BTV recognize the same protein

    • This bidirectional recognition confirms strong antigenic similarity

  • Diagnostic Applications: The expressed HE proteins from either bovine or human toroviruses can be used in dot blot analyses to detect torovirus infection in clinical specimens from both species, further demonstrating their functional and antigenic similarity .

This extensive cross-reactivity suggests that despite host species differences, bovine and human torovirus HE proteins have maintained similar structural and functional characteristics, which has important implications for diagnostic development and evolutionary understanding.

What experimental evidence supports the role of HE in determining torovirus host range and tissue tropism?

While direct experimental evidence specifically linking HE to host range determination in toroviruses is limited in the provided search results, several lines of evidence suggest this connection:

  • Differential Presence Across Species-Specific Toroviruses:

    • Bovine torovirus (BToV) and human torovirus (HTV) both maintain functional HE genes

    • In contrast, equine torovirus (Berne virus, BEV) contains only a truncated pseudogene version

    • This pattern suggests potential correlation with host adaptation

  • Similarity to Other Viral HE Proteins:

    • The torovirus HE shows approximately 30% sequence identity with HE proteins from coronaviruses and influenza C viruses

    • In these other viral families, HE proteins have established roles in receptor binding and host cell recognition

  • Structural Evidence:

    • The HE protein forms short (6 nm) surface projections on BToV virions

    • Such surface proteins typically mediate host cell interactions

  • Functional Conservation:

    • The acetylesterase activity suggests a role in binding/release from sialic acid-containing receptors, which may vary across host species

    • This receptor specificity could potentially influence which hosts and tissues the virus can effectively infect

  • Selection Pressure Patterns:

    • The maintenance of functional HE in natural infections despite ready loss in cell culture suggests important in vivo functions that may relate to host adaptation

A direct experimental approach to test this hypothesis would involve creating recombinant viruses with HE proteins from different torovirus species and assessing changes in host cell tropism, but such studies are not described in the provided search results.

What are the common technical challenges in expressing and purifying functional recombinant BRV-2 HE?

Researchers face several technical challenges when expressing and purifying functional recombinant BRV-2 HE:

  • Protein Stability Issues:

    • The full-length HE protein tends to be unstable during multiple passages

    • Mutations and deletions frequently occur in the HE gene, particularly during viral adaptation to cell culture

  • Expression System Limitations:

    • Baculovirus expression systems have been successfully used, but yields may be limited

    • Proper glycosylation is critical for functional activity, requiring eukaryotic expression systems

    • Purification typically requires sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE), which may affect protein conformation and activity

  • Detection Challenges:

    • HA-tagged full-length HE (HEf/HA) shows variable detection depending on the antibodies used

    • The protein is "barely stained" with some anti-HA antibodies despite being well detected by mouse anti-HE antiserum

    • Immunoblotting detection varies between antibodies, with HEf/HA not being detected by rabbit anti-HA but detectable with mouse anti-HA 12CA5 antibody

  • Activity Preservation:

    • Maintaining acetylesterase activity through purification steps requires careful buffer optimization

    • The α-NA esterase assay provides a useful functional test but requires standardization

To address these challenges, researchers have employed multiple strategies including:

  • Using different expression systems (baculovirus, reverse genetics)

  • Adding epitope tags to facilitate detection and purification

  • Creating multiple clones to compare stability and expression

  • Employing a combination of detection methods to ensure protein identification

How can researchers optimize detection of HA-tagged HE variants with different antibodies?

Based on the research findings, specific strategies can optimize detection of HA-tagged HE variants:

  • Antibody Selection Based on HE Variant:

    • For HEs/HA (soluble HE with HA tag): Both rabbit polyclonal anti-HA and mouse monoclonal anti-HA 12CA5 antibodies provide effective detection in both immunofluorescence and immunoblotting

    • For HEf/HA (full-length HE with HA tag): Mouse monoclonal anti-HA 12CA5 antibody offers superior detection compared to rabbit polyclonal anti-HA, which barely detects this variant

  • Multi-method Approach:

    • Combine indirect immunofluorescence with immunoblotting for comprehensive detection

    • Use confocal laser scanning microscopy for detailed localization studies

    • Alternative detection with mouse anti-HE antiserum offers reliable detection of HEf/HA when anti-HA antibodies show limited reactivity

  • Protocol Optimization for HEf/HA Detection:

    • The research suggests that the HA tag in full-length HE may be partially obscured or differentially presented compared to the tag in soluble HE

    • Adjusting fixation methods (different fixatives or fixation times) may improve epitope accessibility

    • Modifying blocking conditions to reduce background while maintaining specific signal

    • Testing different antibody concentrations specifically optimized for HEf/HA detection

  • Tag Position Consideration:

    • The differential detection between HEs/HA and HEf/HA suggests that tag positioning affects accessibility

    • Future constructs could explore alternative tag locations that maintain protein function while improving detection consistency across antibodies

These optimization strategies can help researchers achieve more consistent and reliable detection of different HA-tagged HE variants, enhancing experimental reproducibility and data quality.

What aspects of BRV-2 HE function remain poorly understood and merit further investigation?

Despite significant advances in characterizing BRV-2 HE, several important aspects remain poorly understood:

  • Precise Role in Viral Pathogenesis:

    • The contrast between HE gene maintenance in natural infections versus rapid loss in cell culture suggests important in vivo functions that remain inadequately characterized

    • Systematic investigation of how HE contributes to tissue tropism, virulence, and disease progression is needed

  • Receptor Specificity and Evolution:

    • The specific cellular receptors recognized by the HE protein have not been fully characterized

    • How receptor specificity might differ between bovine and human torovirus HE proteins requires further investigation

    • The evolutionary pressures that maintain HE in some torovirus lineages but not others remain unclear

  • Structural Determinants of Function:

    • Detailed structural analysis comparing torovirus HE with coronavirus and influenza C virus HE proteins

    • Structure-function relationships within the protein, including key residues for enzymatic activity and receptor binding

    • How HE interactions with other viral proteins might influence virion assembly and stability

  • Immune Evasion Role:

    • Potential contribution to immune evasion through modification of host cell surfaces

    • Role in antibody escape through rapid evolutionary changes

    • Interaction with host innate immune responses

  • Therapeutic and Vaccine Target Potential:

    • Evaluation of HE as a target for antiviral drugs that inhibit its enzymatic activity

    • Assessment of recombinant HE proteins as subunit vaccine candidates

    • Understanding antibody responses against HE during natural infection and their protective capacity

These research gaps represent important opportunities for future studies using the reverse genetics systems and other advanced tools now available for torovirus research.

How might reverse genetics approaches be further developed to study HE evolution in toroviruses?

Future development of reverse genetics for studying HE evolution could employ several innovative approaches:

  • Directed Evolution Systems:

    • Development of systems that apply controlled selective pressures to recombinant viruses

    • Serial passaging in the presence of neutralizing antibodies targeting HE

    • Alternating passages between different cell types to mimic host switching

    • These approaches could reveal evolutionary pathways and constraints on HE adaptation

  • Ancestral Sequence Reconstruction:

    • Computational inference of ancestral HE sequences

    • Creation of recombinant viruses carrying these reconstructed sequences

    • Functional characterization to understand evolutionary trajectories and constraints

    • This could provide insights into the acquisition and modification of HE throughout torovirus evolution

  • Chimeric Virus Construction:

    • Creating viruses with HE genes from different torovirus species or strains

    • Swapping domains between HE proteins of toroviruses, coronaviruses, and influenza C viruses

    • These chimeras could reveal functional modularity and host adaptation mechanisms

  • Deep Mutational Scanning:

    • Creating libraries of HE mutants with comprehensive single amino acid substitutions

    • Selecting for functional variants under different conditions

    • High-throughput sequencing to identify mutational effects on fitness

    • This approach could map functional constraints on HE evolution

  • In Vivo Reverse Genetics:

    • Extending current cell culture-based systems to animal models

    • Studying HE evolution during natural infections with recombinant viruses

    • Tracking genomic changes during transmission chains

    • This would provide more realistic evolutionary dynamics than cell culture alone

These advanced approaches would build upon existing reverse genetics tools to provide deeper insights into HE evolution in the context of host adaptation and immune evasion.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.