Recombinant Brettanomyces anomalus Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Description

Introduction

Cytochrome c oxidase (COX), also known as Complex IV, is a crucial enzyme in the respiratory chain of many organisms, including yeasts. It catalyzes the final step in the electron transfer chain, reducing molecular oxygen to water and creating a proton gradient that drives ATP synthesis. Brettanomyces anomalus (also known as Dekkera anomala) is a non-conventional yeast with significant biotechnological potential, particularly in the food and beverage industry . The COX2 subunit is a vital component of the cytochrome c oxidase enzyme complex.

Brettanomyces anomalus and its Biotechnological Relevance

Brettanomyces anomalus is known for its ability to produce various extracellular enzymes, including β-glucosidases, which can release bound aroma compounds in food and beverages . Genetic manipulation tools are being developed to harness and improve the quality of wine and beer using Brettanomyces yeasts .

Cytochrome c Oxidase (COX) and COX2 Subunit

Cytochrome c oxidase is a large transmembrane protein complex that plays a key role in cellular respiration. It consists of several subunits, each with specific functions. The COX2 subunit binds the oxygen molecule that is reduced to water during oxidative phosphorylation. COX2 is essential for the electron transfer activity of the enzyme .

Recombinant Production of B. anomalus COX2

Recombinant production involves expressing the gene encoding COX2 in a host organism, such as Escherichia coli, to produce large quantities of the protein. This approach is valuable for studying the enzyme's structure, function, and potential applications.

Potential Applications of Recombinant B. anomalus COX2

  1. Enzyme Characterization: Recombinant COX2 can be used to study the biochemical properties of the enzyme, including its kinetics, substrate specificity, and inhibition mechanisms .

  2. Structural Studies: High-resolution structures of COX2 can be determined using X-ray crystallography or cryo-electron microscopy, providing insights into its catalytic mechanism.

  3. Biotechnological Applications: Engineering COX2 for improved activity or stability could enhance its use in various biotechnological processes, such as biosensors or biofuel production.

  4. Food Bioflavoring: B. anomalus β-glucosidase expressed through recombinant methods can be added to cherry beers and forest fruit milks, resulting in increased amounts of aroma compounds like benzyl alcohol, eugenol, linalool, and methyl salicylate .

6.1. β-Glucosidase Activity

B. anomalus exhibits high β-glucosidase activity, which is important for releasing aroma compounds . The β-glucosidase from B. anomalus has optimal activity at a pH of 5.75 and a temperature of 37°C .

6.2. Hop Aroma Conversion

Brettanomyces strains can convert hop-derived compounds, influencing the aroma profile of beer . Oxidoreductases BbHye2 and BbHye3 in Brettanomyces contribute to monoterpene alcohol conversion .

6.3. Carbon Monoxide Inhibition

Cytochrome oxidases are inhibited by carbon monoxide (CO), which competes with oxygen for binding to the active site . The inhibitory effect of CO on cytochrome oxidases decreases as oxygen concentration increases .

Table 1: Impact of B. anomalus β-Glucosidase on Aroma Compounds

Aroma CompoundImpact of B. anomalus β-Glucosidase
Benzyl AlcoholIncreased
EugenolIncreased
LinaloolIncreased
Methyl SalicylateIncreased

Table 2: CO Inhibition of E. coli Terminal Oxidases

Terminal Oxidase$$[O_2]$$ (μM)IC50 (μM CO)
bd-II5088.6 ± 9.3
bd-II100170.4 ± 15.0
bd-II200230.2 ± 12.0
bo35066.5 ± 10.0
bo3100130.6 ± 14.0
bo3200330.1 ± 19.6

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
COX2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-243
Protein Length
full length protein
Species
Brettanomyces anomalus (Yeast)
Target Names
COX2
Target Protein Sequence
MMLNNMLNDVPTPWGMFFQDSATPNMEGMMELHNNVMFYLCMMLGFVSYMLYNMLHNNKS VLPYKYLYHGQFMEMVWTTIPAMMLLMMAFPSFILLYMCDEVMAPAMTIKAMGLQWYWKY EYSDFMDDKGETMEFESYMIPEDLLEEGQLRQLDVDSPMVCPVDTHMRFMVTAADVMHDF AMPSLGIKIDAVPGRLNQTSALIQREGVYYGQCSELCGVMHSSMPMKIEAVSLGEFLAWI DEQ
Uniprot No.

Target Background

Function
Recombinant *Brettanomyces anomalus* Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This enzyme complex, along with succinate dehydrogenase (Complex II, CII) and ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), facilitates electron transfer from NADH and succinate to molecular oxygen. This process generates an electrochemical gradient across the inner mitochondrial membrane, driving ATP synthesis. COX2 plays a critical role in the final step, catalyzing the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site, a binuclear center (BNC) comprised of heme A3 and copper B (CuB) in subunit 1. The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • How can researchers use COX2 for evolutionary studies of Brettanomyces yeast species?

COX2 sequences provide valuable insights into evolutionary relationships among Brettanomyces species due to their appropriate mutation rate for intraspecific and interspecific comparisons.

Methodological approach:

  • Sequence alignment and comparison: Align COX2 sequences from multiple Brettanomyces strains and related yeasts. Identify conserved regions and variable positions.

  • Phylogenetic analysis: Construct phylogenetic trees using methods such as Maximum Likelihood or Bayesian inference. This approach has revealed close phylogenetic relationships between Hansenula and Brettanomyces/Dekkera clades .

  • Analysis of selection pressure: Calculate Ka/Ks ratios to determine whether natural selection is acting on COX2. Seven non-synonymous and nine synonymous substitutions have been observed in various yeast strains, suggesting negative selective pressure on COX2 .

  • Intron analysis: Identify potential horizontal gene transfer (HGT) events by comparing intron sequences. Research has demonstrated that lateral gene transfer and intermolecular DNA recombination have contributed to the evolution of mitochondrial genes in Brettanomyces and related yeasts .

  • Geographical polymorphisms: COX2 sequence positions (e.g., positions 51 and 519) can indicate geographical origin of strains, providing insights into dispersal patterns .

  • What methods should be used to analyze potential horizontal gene transfer involving B. anomalus COX2?

Horizontal gene transfer (HGT) analysis of B. anomalus COX2 requires a systematic approach:

  • Sequence comparison: Perform BLAST comparisons of all mitochondrial introns to identify shared sequences across distantly related species. A conservative threshold (>50% of maximum possible bit score) should be used to classify introns as unique, shared within a group, or shared between groups .

  • Cluster analysis: Generate clusters of related introns based on pairwise BLAST hits. In some studies, 271 clusters of related introns have been identified across yeast species .

  • Phylogenetic incongruence: Compare COX2 gene trees with species trees. Discordance may indicate HGT events.

  • Intron insertion site analysis: Examine the positions of introns in COX2 genes across species. Conserved insertion sites may indicate the action of common homing endonucleases.

  • Comparative genomics: Analyze synteny conservation and gene rearrangements between mitochondrial genomes of different Brettanomyces species .

The evidence of HGT is supported by the complex polyphyletic nature of some yeast species and the established role of interspecies hybridization in yeast evolution .

  • How does B. anomalus COX2 differ from other Brettanomyces species at the genomic and functional levels?

Genomic differences:

Comparative genomic analysis of COX2 among Brettanomyces species reveals significant differences:

SpeciesGenome FeaturesCOX2 Characteristics
B. anomalusFirst genome sequenced in 2016 Higher sequence similarity to Hansenula polymorpha (58%)
B. bruxellensisMultiple strains sequencedContains strain-specific polymorphisms
B. custersianusDistinct genomic organizationMore divergent COX2 sequence
B. naardenensisHighly divergent from other speciesLimited homology to B. anomalus genes

Functional implications:

The genomic background correlates with phenotypic characteristics. While the COX2 protein's primary function in oxidative phosphorylation is conserved, variations may affect:

  • Respiratory efficiency at different environmental conditions

  • Interaction with other respiratory chain components

  • Tolerance to oxygen levels

Research has shown that B. anomalus has different oxygen requirements compared to other Brettanomyces species, which may relate to differences in respiratory chain components, including COX2 .

  • What research approaches are used to study COX2's role in the Custers effect in Brettanomyces species?

The Custers effect (inhibition of fermentation under anaerobic conditions) in Brettanomyces involves redox imbalances that may be linked to mitochondrial function. Research approaches include:

  • Comparative respiratory studies: Investigate oxygen consumption rates and respiratory chain efficiency across different Brettanomyces strains with varying COX2 sequences.

  • Gene expression analysis: Measure expression levels of COX2 and other respiratory genes under aerobic, semi-aerobic, and anaerobic conditions.

  • Metabolite profiling: Monitor production of ethanol and acetic acid under varying oxygen conditions. B. bruxellensis produces approximately 0.7, 2.5, and 12 g/L acetic acid and 86.0, 117.0, and 1.0 mL/L ethanol under anaerobic, semi-aerobic, and aerobic conditions respectively .

  • Redox state measurement: Track NAD+/NADH ratios to understand the relationship between respiratory chain activity and redox balance.

  • Site-directed mutagenesis: Modify specific residues in COX2 to assess their impact on respiratory function and the Custers effect.

The role of COX2 must be evaluated in the context of other redox-related enzymes, including oxidoreductases like BbHye2 and BbHye3, which show 58% similarity to "hansenula yellow enzyme" and may contribute to redox metabolism under anaerobiosis .

  • How can researchers integrate B. anomalus COX2 data with other genomic features for comprehensive phylogenetic studies?

For comprehensive phylogenetic analysis integrating COX2 data with other genomic features:

  • Multi-gene approach: Combine COX2 with other mitochondrial genes (COX1, COX3, COB) and nuclear genes (rRNA genes, β-glucosidase genes) for robust phylogenetic reconstruction.

  • Whole-genome sequencing: Use high-quality whole-genome sequencing combining Nanopore long-read and Illumina short-read data, as demonstrated for B. bruxellensis UMY321 .

  • Bioinformatic pipeline:

    • Map short Illumina reads to reference genomes using BWA-MEM algorithm

    • Apply filter on MAPQ 30 to get uniquely mapped reads

    • Generate consensus sequences for downstream analyses

    • Construct phylogenetic trees using maximum likelihood methods

  • Population structure analysis: Assess ploidy variation across strains. B. bruxellensis, for example, displays variable ploidy of 2n/3n .

  • Correlation analysis: Integrate phylogenetic data with phenotypic characteristics such as β-glucosidase activity, maltose assimilation, and flavor production to reveal genotype-phenotype relationships .

Principal Component Analysis (PCA) of phenotypic parameters correlated with genetic clusters has shown that strain properties can be predicted based on their genetic grouping, explaining 36.5% of variance across the first principal component .

  • What are the methodological challenges in distinguishing between B. anomalus COX2 and nuclear pseudogenes?

Distinguishing between authentic mitochondrial COX2 and nuclear pseudogenes (NUMTs) requires careful methodological approaches:

  • RNA-based verification: Sequence cDNAs made from purified mitochondrial polyadenylated RNA to confirm that sequences correspond to expressed copies and not nuclear pseudogenes .

  • Frameshift analysis: Examine potential frameshift mutations. In some yeasts, a frameshift mutation at position 673 has been observed in the expressed COX2 mRNA, suggesting the existence of frameshift suppression mechanisms in mitochondria .

  • Coverage analysis: During genome sequencing, mitochondrial sequences typically show elevated coverage relative to nuclear genome due to their higher copy number .

  • Primer design: Design primers that specifically target mitochondrial variants rather than nuclear pseudogenes, based on known differences.

  • Phylogenetic consistency: Evaluate whether the sequence clusters with other mitochondrial COX2 sequences or forms outlier branches that might indicate pseudogenes.

  • Functional domain analysis: Verify the presence of conserved functional domains characteristic of genuine COX2 proteins.

Research has identified nuclear mitochondrial DNA sequences (NUMTs) resulting from insertions of mtDNA fragments into chromosomal DNA breaks, and an association between NUMTs and replication origins has been observed in some yeast genomes .

  • How can COX2 analysis be integrated with β-glucosidase studies for comprehensive Brettanomyces characterization?

Integrating COX2 analysis with β-glucosidase studies provides a comprehensive approach to Brettanomyces characterization:

  • Genomic correlation analysis: Evaluate whether specific COX2 haplotypes correlate with β-glucosidase gene presence/absence or activity levels. Research has identified two β-glucosidases in B. bruxellensis (BbBGL1 and BbBGL2) with varying activity levels .

  • Multi-trait phenotyping: Measure both respiratory parameters (linked to COX2 function) and β-glucosidase activity to create a comprehensive phenotypic profile:

    • Growth on cellobiose as sole carbon source

    • Extracellular β-glucosidase activity measurement

    • Oxygen consumption patterns

    • Flavor compound production

  • Co-expression analysis: Investigate whether COX2 and β-glucosidase genes share regulatory patterns under different environmental conditions.

  • Strain classification: Develop a classification system based on both mitochondrial traits and β-glucosidase activity. Research has shown that B. anomalus strains typically display efficient growth on cellobiose and high β-glucosidase activity compared to some B. bruxellensis strains .

  • Application-specific characterization: Assess how mitochondrial function influences flavor development through β-glucosidase activity in food and beverage applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.