Recombinant Brettanomyces custersianus Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Description

Cytochrome c Oxidase (COX) and COX2

Cytochrome c oxidase (COX) is essential for aerobic respiration in most eukaryotes and many bacteria . The enzyme complex is composed of several subunits, each with a specific role in the electron transfer and proton pumping processes . COX2 is a core subunit of the COX enzyme . It binds the copper center (CuA) and is involved in the initial electron transfer from cytochrome c .

Recombinant COX2

Recombinant COX2 refers to the COX2 protein that is produced using recombinant DNA technology. This involves isolating the gene encoding COX2 from Brettanomyces custersianus, cloning it into an expression vector, and introducing the vector into a host organism (e.g., E. coli or yeast) for protein production . The recombinant protein can then be purified and used for various research and industrial applications.

Potential Applications and Research

While the provided has limited information specifically about recombinant Brettanomyces custersianus COX2, the broader context of COX enzymes and Brettanomyces yeasts suggests several potential research areas:

  • Enzyme Characterization: Studying the structure and function of the recombinant COX2 protein to understand its role in the electron transport chain and energy production in Brettanomyces custersianus .

  • Evolutionary Studies: Comparing the COX2 sequence and function across different Brettanomyces species to understand the evolutionary adaptation of these yeasts to various environments .

  • Biotechnology: Exploring the potential use of Brettanomyces COX2 in biofuel production or other biotechnological applications .

  • Drug Discovery: Investigating the use of COX-2 inhibitors as potential chemopreventive or therapeutic agents against colorectal tumorigenesis .

  • Stress Response Mechanisms: Examining the role of COX2 and other mitochondrial proteins in the response of Brettanomyces to stress conditions, such as the presence of hop bitter acids in beer .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us for preferential development.
Synonyms
COX2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Brettanomyces custersianus (Yeast)
Target Names
COX2
Target Protein Sequence
MKEMMMSNMFNDVPTPWAMFFQDSATPNMEGMLELHNNVVFYLCMMLGFVTFMLYNMLTT YNKSVMPYKYLNQGQFMEMMWTTLPAVMLLMIAFPSFILLYMCDEVMAPAMTIKAMGLQW YWKYEYSDFMDEKGDTMEFESYMIPEDLLDEGQLRQLDVDAPIVCPVDTHIRFMVTAADV MHDFSVPSLGLKIDAVPGRLNQMSALMQREGVYYGQCSELCGVMHSSMPMKVEAVPTADF LAWIDEQ
Uniprot No.

Target Background

Function

Recombinant Brettanomyces custersianus Cytochrome c oxidase subunit 2 (COX2) is a component of cytochrome c oxidase (Complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (Complex II, CII), ubiquinol-cytochrome c oxidoreductase (Complex III, CIII), and cytochrome c oxidase (Complex IV, CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient drives transmembrane transport and ATP synthase activity. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred via the CuA center in subunit 2 and heme a in subunit 1 to the binuclear center (BNC) in subunit 1, which consists of heme a3 and CuB. The BNC reduces molecular oxygen to two water molecules, utilizing four electrons from cytochrome c and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of the COX2 gene in Brettanomyces custersianus?

The COX2 gene in B. custersianus is located within the mitochondrial genome and encodes the cytochrome c oxidase subunit 2 protein. Analysis of the mitochondrial genome shows that COX2 forms part of a polycistronic transcription unit, as evidenced by the conservation of large syntenic blocks that match predicted transcription units . The gene contains both coding exons and potentially mobile introns, similar to those observed in related species such as Dekkera bruxellensis . Comparative analysis with sister species has enabled the development of a physical map placing COX2 in a conserved order (L-rRNA COII COIII S-rRNA COI ATPase 8 ATPase 6 Cyt b ATPase 9 Var 1) based on the Saccharomyces cerevisiae genome as reference .

How does B. custersianus COX2 differ from other Brettanomyces species?

B. custersianus COX2 shows distinctive sequence characteristics compared to other Brettanomyces species. Phylogenetic analysis reveals that B. custersianus exhibits unique patterns in its mitochondrial genes compared to its sister species like D. bruxellensis . Surprisingly, industrial isolates of D. bruxellensis show greater similarity to D. custersii (another name for B. custersianus) COX2 than to the type strain of D. bruxellensis . This unexpected relationship suggests potential lateral gene transfer events between these species, highlighting the complex evolutionary history of this gene . Additionally, B. custersianus growth characteristics differ significantly from other Brettanomyces species, with B. custersianus colonies typically growing much slower than species like B. nanus .

What are the functional domains of the B. custersianus COX2 protein?

The COX2 protein in B. custersianus contains several functional domains characteristic of mitochondrial cytochrome c oxidase subunit 2. The N-terminal region includes a leader peptide (approximately the first 15-25 amino acids) that is cleaved during protein maturation . Following this is the mature protein containing copper-binding domains essential for electron transfer and catalytic activity. The protein contains transmembrane domains that anchor it within the inner mitochondrial membrane. Sequence analysis indicates the presence of conserved motifs involved in interaction with other subunits of the cytochrome c oxidase complex, particularly COX1 and COX3, to form the functional respiratory complex IV .

What are the recommended methods for isolating B. custersianus from environmental samples?

Isolation of B. custersianus from environmental samples can be challenging due to its slow growth and the presence of more abundant microorganisms. An effective isolation protocol involves:

  • Environmental sampling focusing on the rhizosphere of plants, which has been identified as a potential natural habitat for Brettanomyces species

  • Initial enrichment culture in selective media containing cycloheximide (to inhibit most fungi) and bromocresol green (a pH indicator that helps identify acid-producing yeasts)

  • Extended incubation periods (7-10 days) to account for B. custersianus' characteristically slow growth compared to other yeasts like Pichia

  • Confirmation of isolates through both morphological assessment and molecular identification via sequencing of the ITS (Internal Transcribed Spacer) region

  • Subculturing at appropriate timepoints to avoid enrichment of faster-growing yeasts that might outcompete B. custersianus

This isolation approach must account for the timing of sample collection, as premature sampling may favor rapidly growing yeasts like Pichia, while B. custersianus requires longer incubation periods to become detectable .

What expression systems are most effective for recombinant production of B. custersianus COX2?

For recombinant expression of B. custersianus COX2, researchers should consider the following expression systems based on the unique challenges presented by this mitochondrial protein:

  • Heterologous yeast expression systems: S. cerevisiae expression systems with mitochondrial targeting sequences provide the most suitable cellular environment for proper folding and assembly of cytochrome c oxidase components .

  • Specialized bacterial systems: Modified E. coli strains designed for membrane protein expression can be used with careful optimization of growth conditions and membrane-targeting sequences.

  • Cell-free expression systems: These may be advantageous for avoiding toxicity issues associated with overexpression of membrane proteins.

When designing expression constructs, researchers should note that:

  • The COX2 coding sequence contains translational regulatory elements within the first 14 codons that act as positive elements required for efficient translation

  • The sequence between codons 15-25 contains inhibitory elements that can suppress translation when removed from their native context

  • Modifications to optimize codon usage should be approached cautiously, as silent mutations in the mRNA sequence can function as suppressors of translational inhibition

A critical consideration is the presence of polycistronic transcription units in the native mitochondrial genome, which may necessitate careful design of expression constructs to preserve important regulatory elements .

How can one verify the proper folding and assembly of recombinant B. custersianus COX2?

Verification of proper folding and assembly of recombinant B. custersianus COX2 requires a multi-faceted approach:

  • Spectroscopic analysis: UV-visible and infrared spectroscopy can confirm the presence of characteristic absorption peaks associated with properly incorporated heme and copper centers.

  • Activity assays: Cytochrome c oxidase activity should be measured using reduced cytochrome c as substrate, monitoring oxygen consumption rates or the oxidation of cytochrome c spectrophotometrically.

  • Blue native PAGE: This technique can assess assembly into higher-order complexes in mitochondrial fractions, allowing visualization of intact cytochrome c oxidase complexes.

  • Immunoprecipitation: Using antibodies against COX2 or other cytochrome c oxidase subunits to verify interactions with partner proteins in the complex.

  • Protease sensitivity assays: Properly folded membrane proteins show characteristic patterns of resistance to proteolytic digestion compared to misfolded variants.

For mitochondrially targeted expression, researchers should additionally verify proper localization using subcellular fractionation, followed by Western blotting with anti-COX2 antibodies or fluorescence microscopy of tagged constructs .

How does phylogenetic analysis of COX2 inform our understanding of Brettanomyces evolution?

Phylogenetic analysis of the COX2 gene provides crucial insights into Brettanomyces evolution:

  • Interspecies relationships: COX2 sequence analysis supports a close phylogenetic relationship between the Hansenula and Brettanomyces/Dekkera clades .

  • Evidence of hybridization: The unexpected similarity between COX2 sequences from industrial D. bruxellensis isolates and D. custersii (B. custersianus) suggests historical hybridization events or lateral gene transfer between these species .

  • Intron dynamics: Analysis of exon-intron organization in COX2 genes from B. custersianus, D. bruxellensis, and H. polymorpha suggests that lateral gene transfer and intermolecular DNA recombination have contributed significantly to the evolution of these mitochondrial DNAs .

  • Polyploidization patterns: COX2 sequence variations help elucidate different trajectories of polyploidization (auto- vs. allopolyploidization) within Brettanomyces species, revealing unique genomic architectures across different ecological niches .

This evidence collectively indicates that COX2 evolution in Brettanomyces has been shaped by complex processes including interspecies hybridization, DNA recombination, and selective pressure associated with adaptation to different environments . The patterns observed support the established role of interspecies hybridization in yeast evolution and help explain current conflicts in yeast taxonomy based on mitochondrial versus nuclear-encoded genes .

What role does intermolecular recombination play in COX2 gene evolution among Brettanomyces species?

Intermolecular recombination plays a significant role in COX2 gene evolution among Brettanomyces species:

  • Origin of intron diversity: The distribution and variability of introns in COX2 genes across Brettanomyces species suggest acquisition through horizontal transfer mechanisms, facilitated by DNA recombination .

  • Mosaic gene structures: Comparison of exon-intron organization in B. custersianus, D. bruxellensis, and H. polymorpha COX1 and rrnL genes reveals evidence of lateral gene transfer and intermolecular DNA recombination .

  • Hybridization consequences: The existence of three different COX1 alleles in related species is difficult to explain without invoking intermolecular recombination events, likely occurring during interspecies hybridization .

  • Taxonomic implications: Recombination between mitochondrial genomes explains observed conflicts in yeast taxonomy based on mitochondrial versus nuclear-encoded genes .

This recombination is supported by current models of mobile group I intron spread in the "homing cycle" and by taxonomic and genome sequencing data demonstrating the complex polyphyletic nature of some yeast species . The evidence suggests that mitochondrial gene recombination has been a significant driver of genomic diversity within the Brettanomyces genus, contributing to their evolutionary adaptation to various ecological niches .

How do genomic rearrangements affect the expression of COX2 in different Brettanomyces species?

Genomic rearrangements significantly impact COX2 expression in Brettanomyces species through several mechanisms:

  • Transcription unit integrity: The COX2 gene typically exists within polycistronic transcription units in the mitochondrial genome. Rearrangements can disrupt these units, affecting coordinated expression of mitochondrial genes .

  • Regulatory element positioning: Analysis shows that two large syntenic blocks on the minus strand almost perfectly match predicted transcription units, suggesting that genomic organization is crucial for proper regulation .

  • Translational control elements: The COX2 mRNA sequence contains both positive and negative regulatory elements within the coding sequence itself. The first 14 codons contain a positively acting element required for translation, while sequences within codons 15-25 can inhibit translation in certain contexts .

  • Loss of heterozygosity (LOH): In polyploid Brettanomyces strains, massive LOH events occur in subpopulation-specific patterns, affecting gene copy number and potentially expression levels of mitochondrial genes including COX2 .

  • Intergenomic interactions: In allopolyploid strains, the presence of divergent genomes can lead to genomic incompatibilities that must be resolved through genomic modifications, which establish conserved patterns of rearranged blocks .

These genomic rearrangements contribute to the phenotypic diversity observed across Brettanomyces species and strains, potentially affecting important characteristics like growth rate, stress tolerance, and metabolic capabilities in different environmental conditions .

How can CRISPR-Cas9 be adapted for genetic manipulation of B. custersianus mitochondrial genes?

Adapting CRISPR-Cas9 for mitochondrial gene editing in B. custersianus presents unique challenges that require specialized approaches:

  • Mitochondrial targeting:

    • Engineer Cas9 with mitochondrial targeting sequences (MTS) derived from B. custersianus mitochondrial proteins

    • Optimize the MTS-Cas9 fusion with linker regions to maintain protein activity after import

    • Validate localization using fluorescent tagging and confocal microscopy

  • RNA import considerations:

    • Design guide RNAs with structural elements recognized by the natural RNA import machinery

    • Alternatively, use RNA polymerase III promoters active in mitochondria for in-organelle transcription

    • Consider using aptamer-based approaches to facilitate guide RNA mitochondrial import

  • Delivery methods optimized for B. custersianus:

    • Develop protoplast transformation protocols specific to B. custersianus's cell wall composition

    • Optimize electroporation parameters based on B. custersianus's unique membrane characteristics

    • Explore conjugation-based approaches using intermediary shuttle organisms

  • Homology-directed repair (HDR) considerations:

    • Design repair templates accounting for the high AT content of mitochondrial DNA

    • Include long homology arms (>500 bp) to improve HDR efficiency in mitochondria

    • Incorporate selectable markers compatible with mitochondrial expression systems

  • Screening strategies:

    • Develop phenotypic screens based on respiratory function

    • Implement PCR-RFLP approaches to detect successful editing events

    • Use heteroplasmy management strategies to promote homoplasmy of edited mtDNA

The slow growth rate of B. custersianus must be considered when designing experiments, as it will extend the timeline for achieving homoplasmic edited strains compared to conventional yeast models.

What are the methodological considerations for studying COX2 translational regulation in B. custersianus?

Studying COX2 translational regulation in B. custersianus requires specialized methodological approaches:

  • Reporter systems:

    • Construct chimeric genes fusing COX2 regulatory elements to reporter genes like ARG8m that can function in mitochondria

    • Test different segments of the COX2 coding sequence (particularly codons 1-14 and 15-25) for positive and negative regulatory effects

    • Design reporter constructs that maintain the native context of these regulatory elements

  • In organello translation assays:

    • Isolate intact mitochondria from B. custersianus

    • Provide labeled amino acids and measure incorporation into newly synthesized proteins

    • Use specific inhibitors to distinguish mitochondrial from contaminating cytosolic translation

  • mRNA structure analysis:

    • Implement SHAPE (Selective 2′-hydroxyl acylation analyzed by primer extension) or DMS-MaPseq to assess mRNA secondary structures in vivo

    • Compare structures of wild-type and mutant COX2 mRNAs to identify regulatory elements

    • Correlate structural features with translational efficiency

  • Polysome profiling:

    • Fractionate mitochondrial ribosomes on sucrose gradients

    • Quantify COX2 mRNA distribution across fractions using RT-qPCR

    • Compare profiles under different conditions or between wild-type and mutant strains

  • Trans-acting factor identification:

    • Perform RNA affinity purification using COX2 mRNA segments as bait

    • Identify bound proteins by mass spectrometry

    • Validate interactions through genetic approaches (knockdowns/knockouts)

Given the evidence that both stimulatory and inhibitory elements exist within the COX2 coding sequence , researchers should specifically investigate how these antagonistic signals are balanced in the native context versus recombinant expression systems.

How does the Custers effect influence the expression and activity of recombinant COX2 in B. custersianus?

The Custers effect—where Brettanomyces ferments glucose faster in the presence of oxygen than anaerobically —has significant implications for recombinant COX2 expression and activity:

This unique metabolic characteristic of Brettanomyces necessitates careful experimental design when working with respiratory chain components like COX2, particularly when recombinant expression strategies are employed.

What are the key molecular characteristics of B. custersianus COX2 compared to other yeast species?

How might comparative analysis of B. custersianus COX2 inform biotechnological applications in alternative energy production?

Comparative analysis of B. custersianus COX2 could significantly advance biotechnological applications in alternative energy production through several avenues:

  • Enhanced bioethanol production:

    • Understanding the unique properties of B. custersianus respiratory chain components could lead to engineered strains with optimized fermentation capabilities

    • The Custers effect in Brettanomyces could be leveraged to design fermentation processes with controlled oxygen levels for maximum efficiency

    • Engineering B. custersianus strains with modified COX2 could potentially improve tolerance to industrial stressors during biofuel production

  • Microbial fuel cell applications:

    • The electron transport properties of cytochrome c oxidase could be exploited in microbial fuel cell design

    • B. custersianus's unique adaptations to various ecological niches might offer advantages in specific microbial fuel cell environments

    • Recombinant COX2 variants could be designed to enhance extracellular electron transfer capabilities

  • Metabolic engineering strategies:

    • Insights from COX2 regulatory mechanisms could inform broader strategies for controlling respiratory versus fermentative metabolism

    • Understanding the intermolecular recombination mechanisms evident in COX2 evolution could provide tools for directed evolution approaches

    • The polyploidization patterns observed in Brettanomyces could guide genome engineering strategies for creating robust industrial strains

  • Bioremediation applications:

    • B. custersianus's adaptation to various environments suggests potential for engineered strains with enhanced capacities for converting waste materials to energy

    • Modified respiratory chain components could improve performance in oxygen-limited environments typical of many waste streams

Future research should focus on creating a comprehensive model of B. custersianus respiratory metabolism, with particular attention to how the unique features of its COX2 contribute to its ecological adaptability and potential industrial applications .

What novel experimental approaches could improve our understanding of the evolutionary history of COX2 in Brettanomyces species?

Several innovative experimental approaches could advance our understanding of COX2 evolution in Brettanomyces:

  • Ancestral sequence reconstruction and functional testing:

    • Reconstruct ancestral COX2 sequences at key evolutionary nodes

    • Express these reconstructed proteins in appropriate host systems

    • Compare functional properties to understand selective pressures driving evolution

  • Experimental evolution with selective pressures:

    • Subject Brettanomyces populations to controlled evolutionary regimes mimicking different ecological niches

    • Track COX2 sequence changes and functional adaptations in real-time

    • Use genome editing to introduce specific mutations identified in natural populations

  • Comprehensive sampling from natural environments:

    • Expand sampling beyond traditional sources (brewing environments) to explore natural habitats like plant rhizospheres

    • Implement metagenomics approaches to identify unculturable Brettanomyces variants

    • Develop improved isolation protocols specifically designed for slow-growing species like B. custersianus

  • Horizontal gene transfer experimentation:

    • Design systems to quantify and characterize mtDNA recombination events between species

    • Test the hypothesis that interspecies hybridization facilitates COX2 gene transfer

    • Create artificial hybrids to study mitochondrial genome dynamics and resolution mechanisms

  • Dating genomic events using molecular clock approaches:

    • Apply Bayesian molecular dating techniques to COX2 sequences

    • Correlate evolutionary divergence with historical events in brewing and wine production

    • Establish a timeline for major hybridization and polyploidization events in Brettanomyces evolution

These approaches would help resolve the complex evolutionary history of Brettanomyces species, particularly regarding the role of lateral gene transfer and hybridization in shaping mitochondrial gene diversity .

How might emerging single-cell technologies enhance our understanding of COX2 expression heterogeneity in B. custersianus populations?

Emerging single-cell technologies offer transformative potential for understanding COX2 expression heterogeneity in B. custersianus populations:

  • Single-cell RNA sequencing (scRNA-seq):

    • Apply protocols adapted for yeast cell wall composition and small RNA content

    • Quantify cell-to-cell variation in COX2 expression within populations

    • Identify distinct transcriptional states potentially related to metabolic adaptation

    • Correlate COX2 expression patterns with broader mitochondrial gene expression programs

  • Single-cell proteomics:

    • Implement mass spectrometry approaches to quantify COX2 protein levels in individual cells

    • Assess post-translational modifications that may vary between individual cells

    • Correlate protein abundances with respiratory chain activity at the single-cell level

  • Spatial transcriptomics:

    • Apply in situ sequencing techniques to colonies or biofilms

    • Map spatial patterns of COX2 expression in structured microbial communities

    • Identify potential spatial coordination of respiratory activity within yeast populations

  • Live-cell imaging technologies:

    • Develop fluorescent reporter systems for tracking COX2 expression dynamics in real-time

    • Implement microfluidic devices to monitor expression under changing environmental conditions

    • Combine with respiratory activity probes to correlate expression with function

  • Single-cell epigenomics:

    • Adapt CUT&Tag or similar approaches for mapping protein-DNA interactions at COX2 loci

    • Identify potential epigenetic regulators of mitochondrial gene expression

    • Track dynamics of regulatory mechanisms across populations and conditions

These approaches would reveal previously unobservable heterogeneity in COX2 expression and function, potentially explaining the remarkable adaptability of Brettanomyces to diverse ecological niches and providing insights into how polyploid genomes coordinate expression of potentially divergent gene copies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.