Recombinant Brettanomyces naardenensis Cytochrome c oxidase subunit 2 (COX2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. Please specify your preferred tag type for prioritized development.
Synonyms
COX2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-248
Protein Length
full length protein
Species
Brettanomyces naardenensis (Yeast)
Target Names
COX2
Target Protein Sequence
MMKELLMNNMLNDVPTPWAMYFQDSATPNMEGIMELHNNVVFYLIIMLCFVTYMLYNIST VYNKSAVAYKYMNHGQFIEMVWTTFPAVMLLIMAFPSFMLLYICDEVMAPAMTIKAMGLQ WYWKYEYSDFMDEKGETIEFESYIIPEDLLEDGQLRMLDVDASVVCPVDTHIRFIVTSAD VIHDFCMPSLGIKIDAAPGRLNQTSALIQREGVYYGQCSELCGVMHSAMPIKIEVVPTAD FLTWIDEQ
Uniprot No.

Target Background

Function

Recombinant Brettanomyces naardenensis Cytochrome c oxidase subunit 2 (COX2): A component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain driving oxidative phosphorylation. This chain comprises three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane. This gradient powers transmembrane transport and ATP synthase. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space (IMS) are transferred via the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site (subunit 1), a binuclear center (BNC) containing heme A3 and copper B (CuB). The BNC reduces molecular oxygen to two water molecules using four electrons from cytochrome c in the IMS and four protons from the mitochondrial matrix.

Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does the COX2 gene contribute to phylogenetic classification within Brettanomyces species?

The COX2 gene serves as a valuable phylogenetic marker for distinguishing between Brettanomyces species due to its relatively slow evolutionary rate combined with sufficient interspecific variation.

Methodological approach for phylogenetic analysis:

  • Sequence comparison: Multiple sequence alignment of COX2 from different Brettanomyces species reveals conservation patterns and species-specific variations.

  • Tree construction: Maximum parsimony phylogenetic trees can be constructed using COX2 sequences, often in combination with other genetic markers such as RAD4, to establish evolutionary relationships .

  • Species delineation: COX2-based phylogenetic analysis helps confirm B. naardenensis as one of the five widely accepted Brettanomyces species (B. anomalus, B. bruxellensis, B. custersianus, B. naardenensis, and B. nanus) .

Genomic studies have shown that B. naardenensis is phylogenetically distinct from other Brettanomyces species, with significant differences in genome organization and metabolic capabilities . This distinction is reflected in the COX2 sequence and has contributed to higher-rank classification revisions within the Saccharomycotina subphylum .

Research shows that while COX2 provides valuable phylogenetic information, comprehensive taxonomic classification requires multi-gene approaches. Harrison's research noted that "more sequence data would be required to build a thorough phylogeny" beyond using just COX2 and RAD4 .

What are the structural and functional characteristics of B. naardenensis COX2?

B. naardenensis Cytochrome c oxidase subunit 2 (COX2) exhibits several key structural and functional features that define its role in cellular respiration:

Key structural elements:

  • Transmembrane domains: Contains hydrophobic regions that anchor the protein within the inner mitochondrial membrane

  • Copper-binding sites: Features conserved amino acid residues that coordinate copper atoms essential for electron transfer

  • Protein size: The full-length protein comprises 248 amino acids with a molecular weight of approximately 28 kDa

  • Conserved motifs: Contains sequence motifs characteristic of the cytochrome c oxidase family, including regions for interaction with other subunits

Functional aspects:

  • Electron transfer: Accepts electrons from cytochrome c and transfers them to other subunits in the complex

  • Proton pumping: Contributes to the proton gradient across the inner mitochondrial membrane

  • Respiratory chain integration: Forms part of Complex IV, the terminal electron acceptor complex that reduces oxygen to water

For experimental work, recombinant versions typically include the complete expression region (amino acids 1-248) . The protein is normally stored in Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage, with repeated freeze-thaw cycles not recommended .

How does B. naardenensis metabolism differ from other Brettanomyces species and what might be COX2's involvement?

B. naardenensis exhibits distinctive metabolic traits compared to other Brettanomyces species, which may be influenced by its respiratory chain components including COX2:

Metabolic characteristics of B. naardenensis compared to other Brettanomyces species:

Metabolic TraitB. naardenensisB. bruxellensisB. anomalusB. custersianus
Maltose utilizationPoorEfficient (beer strains)PowerfulVariable
Cellobiose utilizationEfficientEfficient (wine strains)PowerfulEfficient
Ferulic acid consumptionMinimal (POF-)Efficient (POF+)Efficient (POF+)*Minimal (POF-)
Acetic acid productionLowHighVariableLow
Ethanol productionLowHighVariableLow
β-glucosidase activityPresentVariableHighPresent

*Exception: One B. anomalus strain (CRL-90) identified as POF-negative

Research indicates that B. naardenensis has adapted to specific environmental niches through metabolic specialization. Unlike beer-adapted B. bruxellensis strains that efficiently utilize maltose, B. naardenensis demonstrates stronger preference for cellobiose utilization . Additionally, most B. naardenensis strains lack the ability to metabolize ferulic acid, making them phenolic off-flavor negative (POF-) .

COX2's potential involvement in these metabolic distinctions:

  • The efficiency of the respiratory chain, including COX2 function, may influence the yeast's preference for fermentative versus respiratory metabolism

  • Genome analysis revealed that B. naardenensis possesses expanded sets of genes encoding β-glucosidase (EC 3.2.1.21) and β-galactosidase (EC 3.2.1.23), which may interact with respiratory chain function during growth on complex carbon sources

  • The generally lower ethanol and acetic acid production in B. naardenensis compared to B. bruxellensis suggests differences in redox balancing, potentially involving the respiratory chain

These metabolic distinctions highlight the biotechnological potential of B. naardenensis for producing beverages with specific characteristics, including low alcohol content and high attenuation degree .

What expression systems and purification strategies are optimal for producing recombinant B. naardenensis COX2?

Producing functional recombinant B. naardenensis COX2 requires careful consideration of expression systems and purification strategies due to its membrane-associated nature:

Recommended expression systems:

  • Heterologous yeast expression:

    • Saccharomyces cerevisiae or Pichia pastoris systems provide similar post-translational modification machinery

    • Expression using inducible promoters (GAL1, AOX1) allows controlled protein production

    • Growth at 25-30°C with low induction temperatures (20°C) improves proper folding

  • Bacterial expression with modifications:

    • E. coli strains specialized for membrane proteins (C41/C43, Lemo21)

    • Codon optimization based on the known COX2 sequence

    • Use of solubility-enhancing fusion partners (MBP, SUMO, GST)

Purification strategy framework:

  • Membrane preparation:

    • Gentle cell lysis using glass beads or enzymatic methods

    • Differential centrifugation to isolate membrane fractions

    • Careful solubilization using mild detergents (DDM, LDAO, OG)

  • Chromatography sequence:

    • Affinity chromatography using engineered tags (His6, FLAG)

    • Ion exchange chromatography for further purification

    • Size exclusion chromatography to remove aggregates and assess oligomeric state

  • Protein stabilization:

    • Maintain detergent above critical micelle concentration throughout purification

    • Consider nanodiscs or amphipols for final preparation

    • Addition of glycerol (10-20%) to stabilize the protein structure

Functional verification methods:

  • Spectroscopic analysis:

    • Absorption spectrum to verify heme incorporation

    • Circular dichroism to assess secondary structure integrity

  • Activity assays:

    • Oxygen consumption measurements

    • Cytochrome c oxidation kinetics

While specific methods for B. naardenensis COX2 expression are not detailed in the available literature, the complete amino acid sequence (248 residues) provides the foundation for designing optimized expression constructs.

How can gene editing techniques be applied to study COX2 function in B. naardenensis?

Genetic manipulation of COX2 in B. naardenensis requires specialized approaches due to the yeast's non-conventional genetic characteristics. A comprehensive methodological framework includes:

Gene editing strategy development:

  • CRISPR-Cas9 system adaptation:

    • Design guide RNAs targeting specific regions of COX2 using the known sequence

    • Optimize codon usage of Cas9 for B. naardenensis expression

    • Develop appropriate selection markers based on B. naardenensis auxotrophies or drug sensitivities

  • Homologous recombination approach:

    • Design constructs with 500-1000 bp homology arms flanking COX2

    • Include reporter genes (GFP) for tracking expression

    • Introduce specific mutations in functional domains

Transformation protocol optimization:

  • Cell wall modification:

    • Enzymatic treatment using zymolyase or lyticase

    • Optimization of digestion time and enzyme concentration

    • Osmotic stabilization during transformation

  • DNA delivery methods:

    • Electroporation with specialized parameters

    • Lithium acetate/PEG method adapted for Brettanomyces

    • Agrobacterium-mediated transformation as an alternative approach

Functional analysis of COX2 mutants:

  • Respiratory phenotype characterization:

    • Growth assessment on fermentable vs. non-fermentable carbon sources

    • Oxygen consumption rate measurement

    • Mitochondrial membrane potential analysis using fluorescent dyes

  • Metabolic profiling:

    • Comparative analysis of fermentation products (ethanol, acids)

    • Carbon source utilization patterns

    • Stress response under various conditions

The genomic background of B. naardenensis must be considered when designing gene editing experiments. With a genome size of approximately 11.3 Mb distributed across 76 contigs and containing 5,168 protein-coding sequences , care must be taken to ensure specificity when targeting the COX2 gene.

Such genetic engineering approaches would allow researchers to investigate how COX2 variants affect the distinctive metabolic characteristics of B. naardenensis, potentially enhancing its biotechnological applications in beverage production .

What role does COX2 play in B. naardenensis adaptation to different environmental stresses?

COX2 likely plays a significant role in B. naardenensis' adaptation to various environmental stresses, particularly those relevant to its natural and industrial habitats:

Stress response mechanisms involving COX2:

  • Oxidative stress handling:

    • As part of Complex IV, COX2 reduces molecular oxygen to water

    • Efficient electron transfer through COX2 prevents electron leakage that would generate reactive oxygen species (ROS)

    • COX2 dysfunction could compromise cellular antioxidant defense mechanisms

  • Energy generation during stress:

    • Functional respiratory chain ensures ATP generation through oxidative phosphorylation

    • Higher energy availability enhances stress response protein synthesis

    • COX2 efficiency may determine survival under nutrient limitation

B. naardenensis-specific stress adaptations:

B. naardenensis shows distinct stress tolerance characteristics that may involve COX2:

  • Carbon source flexibility:

    • Unlike beer-adapted B. bruxellensis strains that efficiently use maltose, B. naardenensis shows stronger preference for cellobiose

    • This metabolic adaptation may be linked to respiratory chain function during carbon limitation

  • Nitrate assimilation:

    • B. naardenensis can efficiently assimilate nitrate from the environment

    • This process is linked to NAD(P)H reoxidation and redox balance

    • COX2 function may influence the efficiency of this alternative nitrogen utilization pathway

Methodological framework for investigation:

  • Comparative transcriptomics:

    • Analysis of COX2 expression levels under various stress conditions

    • Correlation with stress response genes

  • Mitochondrial function assessment:

    • Membrane potential measurements using fluorescent dyes

    • Respiration rate determination under stress conditions

    • Morphological analysis of mitochondria during stress response

Understanding COX2's role in stress adaptation has significant implications for utilizing B. naardenensis in biotechnological applications, particularly for fermentation processes under stressful industrial conditions .

How do mutations in COX2 affect respiratory function and fermentation characteristics in B. naardenensis?

Mutations in COX2 can significantly impact respiratory function and consequently alter fermentation characteristics in B. naardenensis. While specific studies on B. naardenensis COX2 mutations are not detailed in the available literature, a research-based analytical framework can be constructed:

Critical functional domains and potential mutation impacts:

  • Copper-binding sites:

    • Mutations in copper coordination residues would likely abolish electron transfer capability

    • Expected phenotype: complete respiratory deficiency, forced fermentative metabolism

  • Transmembrane domains:

    • Alterations in membrane-spanning regions could affect protein insertion and stability

    • Expected phenotype: reduced respiratory efficiency, partial shift to fermentation

  • Subunit interaction interfaces:

    • Mutations at interfaces with other complex IV subunits would disrupt complex assembly

    • Expected phenotype: compromised respiration, potential mitochondrial stress response

Metabolic consequences of respiratory impairment:

Metabolic ParameterWild-type COX2COX2 Mutant (predicted)
Growth on fermentable carbonNormalNormal to enhanced
Growth on non-fermentable carbonNormalReduced to absent
Ethanol productionModerateIncreased
Acetic acid productionLowVariable (strain-dependent)
ROS generationLowElevated
Stress toleranceHighCompromised
Nitrate assimilationEfficientPotentially enhanced*

*Nitrate assimilation may increase as an alternative means of NAD(P)H reoxidation when respiratory chain function is compromised

Experimental approach for investigation:

  • Mutagenesis strategy:

    • Site-directed mutagenesis targeting key functional residues

    • Random mutagenesis followed by screening for respiratory deficiency

    • CRISPR-Cas9 genome editing for precise alterations

  • Phenotypic characterization:

    • Oxygen consumption measurements

    • Growth profiling on different carbon sources

    • Metabolite analysis during fermentation

These investigations would be particularly valuable given B. naardenensis' potential for producing beverages with low alcohol content , as COX2 mutations might alter this industrially relevant characteristic.

What analytical methods are most effective for studying B. naardenensis COX2 interactions with other proteins in the respiratory chain?

Investigating B. naardenensis COX2 interactions with other respiratory chain components requires specialized approaches to capture both stable and transient protein-protein interactions. A comprehensive analytical framework includes:

In vivo interaction methods:

  • Split-reporter systems:

    • Split-GFP or split-luciferase fusions to COX2 and potential partners

    • Bimolecular Fluorescence Complementation (BiFC) for visualizing interactions

    • Advantages: Captures interactions in native cellular environment

    • Limitations: May affect protein folding or function

  • Proximity-dependent labeling:

    • BioID or APEX2 fusion to COX2 for proximity-based biotinylation

    • Mass spectrometry identification of biotinylated proteins

    • Advantages: Detects weak or transient interactions

    • Protocol considerations: Requires optimization of expression levels and labeling conditions

In vitro and biochemical approaches:

  • Co-immunoprecipitation strategies:

    • Epitope tagging of COX2 using the known sequence

    • Affinity purification combined with mass spectrometry (AP-MS)

    • Western blot validation of specific interactions

    • Technical considerations: Detergent selection crucial for maintaining interactions

  • Crosslinking mass spectrometry (XL-MS):

    • Chemical crosslinking of interacting proteins

    • MS/MS analysis to identify crosslinked peptides

    • Structural modeling of interaction interfaces

    • Advantages: Provides spatial constraints for interaction modeling

Structural biology approaches:

  • Cryo-electron microscopy:

    • Purification of intact respiratory complexes

    • Single-particle analysis for structural determination

    • Advantages: Visualizes native complex architecture

    • Challenges: Requires highly pure, homogeneous samples

  • Blue Native PAGE analysis:

    • Separation of intact respiratory complexes

    • Western blotting to identify complex components

    • In-gel activity assays to correlate structure with function

    • Technical considerations: Gentle solubilization conditions required

These methodologies would be particularly valuable for understanding how COX2 contributes to the distinctive metabolic characteristics of B. naardenensis, including its efficient cellobiose utilization and low ethanol production , which may be influenced by respiratory chain efficiency.

How does the genetic diversity of B. naardenensis COX2 across different strains correlate with phenotypic variations?

The genetic diversity of COX2 across B. naardenensis strains may contribute to phenotypic variations in metabolism, stress tolerance, and industrial performance. A systematic approach to investigating this correlation includes:

Strain diversity assessment methodology:

  • Comparative genomic analysis:

    • Whole genome sequencing of multiple B. naardenensis strains

    • Identification of COX2 sequence variants

    • Analysis of selection pressure (dN/dS ratios) on COX2

  • Population genetics metrics:

    • Nucleotide diversity (π) calculation across strains

    • Identification of conserved vs. variable regions

    • Haplotype network construction

Structure-function correlation:

  • Variant impact prediction:

    • Mapping variants onto protein structural models

    • Prediction of functional consequences using computational tools

    • Identification of variants in critical functional domains

  • Experimental validation:

    • Site-directed mutagenesis to introduce observed variants

    • Functional assays measuring respiratory efficiency

    • Growth and metabolic profiling

Strain phenotyping framework:

Phenotypic ParameterMeasurement Methodology
Respiratory efficiencyOxygen consumption rate, growth on non-fermentable carbon sources
Fermentation characteristicsEthanol yield, acid production, carbon source preference
Stress toleranceSurvival rate under oxidative, osmotic, and ethanol stress
Industrial performanceAttenuation degree, flavor compound production, fermentation time

Research applications:

  • The identification of natural COX2 variants among B. naardenensis strains could reveal evolutionary adaptations to different environmental niches

  • Understanding the genotype-phenotype relationship could guide strain selection for specific biotechnological applications

  • Beneficial COX2 variants could potentially be introduced into production strains for improved performance

Limited research exists on strain-level diversity within B. naardenensis compared to other Brettanomyces species like B. bruxellensis , making this an important area for future investigation. Studies have identified clear population trends in carbon assimilation among Brettanomyces species , and COX2 diversity may contribute to these phenotypic patterns.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.