Recombinant Brevibacillus brevis Cobalamin synthase (cobS)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Brevibacillus brevis Cobalamin Synthase (cobS)

Recombinant Brevibacillus brevis cobalamin synthase (cobS) is a genetically engineered enzyme produced through heterologous expression in Escherichia coli. This protein plays a critical role in the biosynthesis of cobalamin (vitamin B12), catalyzing the condensation of adenosylcobinamide-GDP (AdoCbi-GDP) and α-ribazole-phosphate (α-RP) to form adenosylcobalamin-5′-phosphate (AdoCbl-P), a penultimate intermediate in the cobalamin pathway .

Functional Role in Cobalamin Biosynthesis

cobS operates in the final stages of cobalamin synthesis, where it interacts with two key partners:

  1. CobC (AdoCbl 5′-phosphate phosphatase): Dephosphorylates AdoCbl-P to yield adenosylcobalamin (AdoCbl), the active coenzyme .

  2. PspA (phage shock protein A): Stabilizes membrane integrity when cobS is overexpressed, mitigating proton motive force (PMF) dissipation .

Mechanistic Insights
In E. coli, elevated cobS levels disrupt PMF and membrane stability, leading to growth arrest. Coexpression of cobC and pspA rescues this phenotype, suggesting a regulatory complex involving cobS, CobC, and membrane-associated proteins .

Key Studies

Study FocusFindingsSource
Toxicity in E. coliOverexpression disrupts PMF, countered by CobC/PspA coexpression
Enzyme-Lipid InteractioncobS associates with liposomes, requiring CobC for membrane anchoring
Biosynthetic PathwayscobS distinguishes between anaerobic and aerobic cobalamin pathways

Critical Knowledge Gaps

  • Structural characterization of cobS remains limited, with no crystallographic data available .

  • The role of cobS in Brevibacillus brevis PGPR activities (e.g., plant growth promotion) is unexplored .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquot for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
cobS; BBR47_12420; Adenosylcobinamide-GDP ribazoletransferase; Cobalamin synthase; Cobalamin-5'-phosphate synthase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-246
Protein Length
full length protein
Species
Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Target Names
cobS
Target Protein Sequence
MNAFLHAISFFTRIPVPWLRPSEEAWRKSVNWYPAVGLVIGLLLWGVHQAGLVLFSPWIA AILTLIAWVYVTGGLHMDGWMDLADGLGSSRPREQILAIMKDSRVGAMGVLAAIMLLLIK AGAVAELAHPGWGSFLIVAPVAARTHVLLSIKLWPYLSADKGIGKGISSGLSVSSIIVSY IIVFAAGWYLGGLQVMTAIFLSLLFALWFSRSVAKKLGGLNGDCYGAVIESSEAVVLLVL VGSWWL
Uniprot No.

Target Background

Function
Cobalamin synthase (cobS) from Brevibacillus brevis catalyzes the joining of adenosylcobinamide-GDP and alpha-ribazole to generate adenosylcobalamin (Ado-cobalamin). Additionally, it synthesizes adenosylcobalamin 5'-phosphate from adenosylcobinamide-GDP and alpha-ribazole 5'-phosphate.
Database Links
Protein Families
CobS family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Brevibacillus brevis and why is it valuable as an expression system?

Brevibacillus brevis (formerly Bacillus brevis) is a Gram-positive bacterium that has gained significant attention in recombinant protein production due to its exceptional protein secretion capabilities. The Brevibacillus expression system has been successfully employed for the efficient production of diverse recombinant proteins, including enzymes, cytokines, antigens, and antibody fragments .

The system offers several advantages:

  • Proteins are secreted directly into the culture medium, simplifying purification

  • Minimal extracellular proteolytic activity, resulting in higher protein integrity

  • Lacks endotoxins (unlike E. coli), making it suitable for therapeutic protein production

  • Capable of high-density cell cultures with gram-per-liter protein yields

  • Demonstrates ability to maintain native protein structure and function

In fed-batch high-density cell cultures, recombinant proteins like Trastuzumab Fab with amino-terminal His-tag have achieved yields of 1.25 g/liter , demonstrating the system's productivity potential.

What is cobalamin synthase (cobS) and what role does it play in vitamin B12 biosynthesis?

Cobalamin synthase (cobS) is classified as cobalamin 5′-phosphate synthase (TIGR01650) and plays an essential role in the vitamin B12 (cobalamin) biosynthetic pathway. It functions as part of an ATP-dependent heterotrimeric enzyme complex in aerobic bacteria like Pseudomonas denitrificans, working alongside cobN (magnesium chelatase) and cobT (cobalt chelatase) to catalyze cobalt chelation in the corrin ring structure of vitamin B12 .

The enzyme is specifically involved in the assembly of the nucleotide loop of cobalamin, which is critical for the molecule's function as a cofactor. In the aerobic cobalamin biosynthetic pathway, cobS works within a complex system involving approximately 30 enzymatic steps that transform simple precursors into the complex cobalamin structure .

How does the cobalamin biosynthetic pathway differ between aerobic and anaerobic bacteria?

The cobalamin biosynthetic pathway exhibits significant differences between aerobic and anaerobic bacteria:

Aerobic pathway (e.g., in Pseudomonas denitrificans):

  • Utilizes five S-adenosyl-L-methionine (SAM)-dependent methyltransferases (CobA, I, J, M, and F) for introducing six methyl groups

  • Characterized by molecular oxygen incorporation via monooxygenase CobG

  • Cobalt chelation catalyzed by ATP-dependent heterotrimeric enzyme (CobN, CobS, CobT)

  • After cobalt insertion, reduction of Co(II) to Co(I) is catalyzed by flavin-dependent cob(II)yrinic acid a,c-diamide reductase (CobR)

Anaerobic pathway (e.g., in Salmonella typhimurium):

  • Requires different methyltransferases: CysG, CbiK/X, and CbiLHF

  • Employs ATP-independent enzymes CbiK/X for cobalt insertion

  • Utilizes cobalt-precorrin intermediates rather than precorrin intermediates

  • Involves multifunctional cobalt-sirohydrochlorin C20-methyltransferase (CbiL) and other specialized enzymes

Notably, despite sharing similar names, enzymes CobT, CobU, and CobS in the aerobic pathway are non-homologous to enzymes with the same symbols in the anaerobic pathway due to their discovery history .

What are the safety considerations when working with recombinant proteins produced in Brevibacillus brevis?

Recombinant proteins produced in Brevibacillus brevis demonstrate favorable safety profiles compared to those produced in other expression systems:

  • Studies examining recombinant cholera toxin B subunit (rCTB) secreted by B. brevis showed no toxic effects to macrophages and no vascular permeability-increasing effects, unlike the natural cholera toxin (CT) or even commercially produced natural CTB

  • As a Gram-positive bacterium, B. brevis lacks endotoxins (lipopolysaccharides) that can contaminate proteins produced in Gram-negative systems like E. coli

  • No distinct local histopathological reactions were observed in nasal cavity, small-intestinal loop or muscle tissues exposed to rCTB produced in B. brevis

  • Incubation of guinea-pig peritoneal macrophages with rCTB from B. brevis showed significantly lower lactate dehydrogenase release compared to cholera toxin or aluminum hydroxide gel

These findings suggest that recombinant proteins produced in B. brevis may be particularly suitable for applications requiring high safety standards, such as therapeutic proteins or mucosal adjuvants.

What factors most significantly affect the expression efficiency of cobS in Brevibacillus brevis?

The expression efficiency of cobS in Brevibacillus brevis is influenced by multiple factors:

Genetic factors:

  • Promoter strength and regulation mechanism (constitutive vs. inducible)

  • Signal peptide efficiency for secretion

  • Codon optimization matching B. brevis preferences

  • Gene copy number and plasmid stability

  • Presence of enhancer elements or transcription terminators

Culture conditions:

  • Temperature affects both growth rate and protein folding (typically optimal between 25-37°C)

  • Media composition, particularly carbon and nitrogen sources

  • Metal ion supplementation, especially cobalt for cobS functionality

  • Dissolved oxygen levels, critical for aerobic metabolism

  • Cultivation time and growth phase at harvest

Process parameters:

  • In fed-batch cultivation, the feeding strategy significantly impacts final yields

  • pH control throughout fermentation

  • Specific growth rate control via nutrient limitation

  • Scale-up factors in bioreactor systems

In a comparative study with recombinant antibody fragments in B. choshinensis (closely related to B. brevis), researchers achieved secretion levels of 1.25 g/liter using fed-batch high-density cell culture techniques , demonstrating the potential for high-yield expression when conditions are optimized.

How can researchers effectively purify recombinant cobS from Brevibacillus brevis culture supernatants?

Effective purification of recombinant cobS from B. brevis culture supernatants involves a strategic multi-step approach:

Initial processing:

  • Removal of cells by centrifugation (5,000-10,000 × g, 15-30 min) or filtration (0.22-0.45 μm)

  • Concentration of supernatant by tangential flow filtration or ammonium sulfate precipitation

  • Buffer exchange to optimize for subsequent chromatography steps

Chromatographic purification strategy:

  • Capture step: Affinity chromatography if cobS contains an affinity tag (e.g., His-tag)

  • Intermediate purification: Ion exchange chromatography based on cobS's theoretical isoelectric point

  • Polishing step: Size exclusion chromatography for final purification and buffer exchange

Method optimization considerations:

  • For His-tagged proteins, imidazole concentration gradients should be optimized to minimize non-specific binding

  • pH and salt concentration adjustments can significantly improve selectivity in ion exchange steps

  • The presence of specific cofactors or metal ions may be necessary to maintain cobS stability during purification

In studies with recombinant antibody fragments produced in B. choshinensis, researchers successfully purified proteins to homogeneity using a combination of conventional column chromatography techniques with yields of 10-13% . Similar approaches can be adapted for cobS purification, with specific modifications based on its unique biochemical properties.

What methods are most effective for assessing the functional activity of recombinant cobS?

Effectively assessing the functional activity of recombinant cobS requires a multi-faceted approach:

Enzymatic activity assays:

  • ATP consumption measurement using coupled enzyme assays (e.g., pyruvate kinase/lactate dehydrogenase system)

  • Direct product formation detection via HPLC or mass spectrometry

  • Coupled assays with other enzymes in the cobalamin biosynthetic pathway

Structural and biophysical assessments:

  • Circular dichroism (CD) spectroscopy to verify secondary structure integrity, similar to approaches used with other recombinant proteins produced in B. brevis

  • Size exclusion chromatography to confirm proper oligomeric state

  • Thermal shift assays to evaluate protein stability under various conditions

Functional complementation:

  • Genetic complementation in cobS-deficient strains to assess in vivo functionality

  • Reconstitution of the CobNST complex in vitro to evaluate functional integration

Binding studies:

  • Surface plasmon resonance (SPR) to measure binding affinities for substrate molecules

  • Isothermal titration calorimetry (ITC) to determine thermodynamic parameters of binding

  • Fluorescence-based binding assays if suitable fluorophores can be identified

A combination of these methods provides comprehensive assessment of both structural integrity and catalytic function of the recombinant cobS enzyme.

How can researchers engineer Brevibacillus brevis strains for improved cobS expression and activity?

Engineering B. brevis strains for improved cobS expression and activity can be approached through several targeted strategies:

Genetic modifications:

  • Promoter engineering:

    • Testing various constitutive and inducible promoters

    • Creating synthetic promoter libraries with varying strengths

    • Developing feedback-regulated promoters responsive to metabolic state

  • Signal peptide optimization:

    • Screening natural B. brevis signal peptides for optimal cobS secretion

    • Engineering hybrid signal peptides with enhanced efficiency

    • Optimizing the signal peptide cleavage site

  • Host strain engineering:

    • Development of protease-deficient strains to reduce degradation

    • Engineering strains with enhanced secretion capacity

    • Creating strains with improved cofactor synthesis pathways, particularly for cobalamin-related compounds

Metabolic engineering:

  • Enhancing precursor supply:

    • Amplifying pathways that generate required metabolites

    • Reducing competing pathways that drain precursors

    • Balancing redox state to support cobS activity

  • Cofactor availability:

    • Overexpression of genes involved in cobalt uptake and metabolism

    • Engineering pathways for improved ATP generation

    • Optimizing metal ion homeostasis

  • Stress response modulation:

    • Enhancing chaperone expression for improved protein folding

    • Engineering strains with improved resistance to secretion stress

    • Modifying cell wall properties to facilitate protein secretion

These approaches can be combined and optimized through Design of Experiments (DOE) methodology to identify the most effective combination of modifications for enhanced cobS production.

What are the challenges in adapting the full vitamin B12 biosynthesis pathway into heterologous expression systems like Brevibacillus?

Adapting the complete vitamin B12 biosynthesis pathway into heterologous systems like Brevibacillus presents several significant challenges:

Pathway complexity:

  • The biosynthetic pathway involves approximately 30 enzymatic steps, making it one of the most complex biosynthetic pathways known

  • Coordinating the expression levels of all necessary enzymes requires precise genetic control

  • Both aerobic and anaerobic pathways represent distinct challenges in terms of oxygen requirements and enzyme compatibility

Genetic burden:

  • Introducing ~30 genes creates substantial metabolic burden on the host

  • Codon optimization of multiple genes requires significant bioinformatic analysis

  • Maintaining stable expression of all components over extended cultivation periods

Biochemical challenges:

  • Requirement for precise ratios of enzymes for efficient pathway function

  • Need for specialized cofactors and metal ions, particularly cobalt

  • Formation of proper protein-protein interactions between pathway components

Metabolic integration:

  • Ensuring sufficient precursor supply without disrupting host metabolism

  • Balancing redox requirements across numerous enzymatic steps

  • Preventing toxic intermediate accumulation

Regulatory complexities:

  • Understanding and managing complex regulatory mechanisms governing the pathway

  • Temporal coordination of enzyme expression throughout the biosynthetic process

  • Feedback inhibition mechanisms that may limit final product yields

Successful implementation would require a systematic approach, potentially beginning with smaller pathway modules before integration of the complete pathway.

What expression vector systems are most effective for recombinant cobS production in Brevibacillus brevis?

Several expression vector systems have been developed for recombinant protein production in Brevibacillus brevis, with specific features that make them suitable for cobS expression:

B. choshinensis/BIC (Brevibacillus in vivocloning) expression system:

  • Successfully employed for efficient production of various recombinant proteins including enzymes, cytokines, antigens, and antibody fragments

  • Demonstrated capability for high-level secretion in fed-batch culture (up to 1.25 g/L for recombinant antibody fragments)

  • Features well-characterized promoters and signal sequences optimized for secretion

Key vector components to consider:

  • Origin of replication:

    • Should be compatible with B. brevis replication machinery

    • Stability during prolonged cultivation is critical

    • Copy number influences expression levels and metabolic burden

  • Promoter selection:

    • Constitutive promoters (like P2) for continuous expression

    • Inducible systems for controlled expression timing

    • Promoter strength should be matched to protein complexity and cell metabolism

  • Signal peptides:

    • B. brevis cell wall protein (cwp) signal peptide shows high efficiency

    • Modified signal peptides with enhanced cleavage properties

    • Codon optimization at the signal peptide-mature protein junction improves processing

  • Selection markers:

    • Antibiotic resistance genes compatible with B. brevis physiology

    • Auxotrophic markers for antibiotic-free selection systems

    • Dual selection systems for enhanced plasmid stability

  • Additional elements:

    • Transcriptional terminators to prevent read-through

    • Multiple cloning sites for convenient insertion

    • Affinity tag options (His-tag, FLAG-tag) for simplified purification

When designing vectors specifically for cobS expression, consideration should be given to the enzyme's size, complexity, and potential cofactor requirements.

How can researchers optimize culture media for maximum cobS production in Brevibacillus brevis?

Optimizing culture media for maximum cobS production in Brevibacillus brevis requires careful consideration of multiple components:

Carbon sources:

  • Complex carbon sources like glucose, sucrose, or glycerol at 1-5% concentration

  • Fed-batch supplementation to maintain optimal carbon levels without causing overflow metabolism

  • Gradual feeding strategies to avoid catabolite repression

Nitrogen sources:

  • Combination of organic (peptone, tryptone, yeast extract) and inorganic (ammonium salts) nitrogen

  • Typical concentrations: peptone (0.5-2%), yeast extract (0.5-2%), ammonium salts (0.1-0.5%)

  • Amino acid supplementation may enhance specific protein production

Metal ions and trace elements:

  • Cobalt supplementation (10-50 μM) is critical specifically for cobS functionality

  • Magnesium (0.5-2 mM) to support ATP-dependent enzymatic activity

  • Trace element solution including Fe, Zn, Mn, Cu at appropriate concentrations

Buffering and stabilizing agents:

  • MOPS or phosphate buffer systems (50-100 mM) to maintain optimal pH

  • Addition of stabilizing agents like polyethylene glycol or specific metal chelators

  • Osmoprotectants such as betaine or proline to enhance cell stability

Optimization approach:

  • Initial screening using shake flask cultures with varied media compositions

  • Design of Experiments (DOE) methodology to identify significant factors and interactions

  • Response surface methodology to fine-tune optimal concentrations

  • Scale-up to controlled bioreactor conditions with online monitoring and control

A systematic optimization process typically leads to 2-5 fold improvement in protein yields compared to standard media formulations.

What are the critical parameters to monitor and control during fermentation for recombinant cobS production?

Critical parameters for monitoring and controlling fermentation for recombinant cobS production include:

Physical parameters:

  • Temperature:

    • Typically maintained between 25-37°C depending on strain and expression system

    • Lower temperatures (25-30°C) often favor proper protein folding

    • Online monitoring and control within ±0.5°C is recommended

  • pH:

    • Optimal range typically 6.8-7.5 for B. brevis growth and protein expression

    • Automatic control using acid/base addition

    • pH shifts can indicate metabolic changes or contamination

  • Dissolved oxygen (DO):

    • Critical for aerobic metabolism and protein folding

    • Typically maintained above 20-30% saturation

    • Controlled through agitation speed, airflow rate, and enriched air as needed

Nutritional parameters:

  • Carbon source concentration:

    • Monitor consumption rate to avoid depletion

    • Feed rate in fed-batch culture should match consumption rate

    • Typical setpoint for glucose: 5-20 g/L

  • Nitrogen source:

    • Monitor amino acid consumption if possible

    • Supplement with complex nitrogen sources as needed

    • Feed rate adjusted based on growth and protein expression

  • Trace elements and vitamins:

    • Periodic supplementation may be necessary for extended fermentations

    • Special attention to cobalt levels for cobS functionality

Growth and production parameters:

  • Biomass concentration:

    • Online monitoring via optical density, capacitance, or dry cell weight

    • Growth rate calculation for feed rate determination

    • Typical high-density cultures reach 30-80 g/L dry cell weight

  • Protein production:

    • Regular sampling for protein quantification

    • Monitoring of proteolytic activity in the medium

    • Assessment of protein quality and activity

  • Metabolic indicators:

    • Oxygen uptake rate and carbon dioxide evolution rate

    • By-product formation (organic acids)

    • Redox potential

Integrated process analytical technology (PAT) approaches combining multiple measurements provide the most comprehensive process understanding and control.

What methods can researchers use to enhance the solubility and stability of recombinant cobS?

Enhancing solubility and stability of recombinant cobS can be achieved through various complementary approaches:

Genetic strategies:

  • Fusion partners:

    • Solubility-enhancing tags (MBP, SUMO, thioredoxin)

    • Thermostabilizing domains from thermophilic organisms

    • Inclusion of cleavable linkers for tag removal after purification

  • Protein engineering:

    • Site-directed mutagenesis of aggregation-prone regions

    • Surface charge modification to increase hydrophilicity

    • Disulfide bond engineering for enhanced stability

    • Removal of proteolytically sensitive sites

Expression conditions:

  • Temperature modulation:

    • Lowering culture temperature (20-25°C) to slow folding kinetics

    • Heat shock response induction prior to expression

    • Temperature cycling for specific protein classes

  • Chemical additives during expression:

    • Osmolytes such as glycerol (5-10%), sucrose, or trehalose

    • Specific metal ions, particularly cobalt for cobS

    • Low concentrations of non-ionic detergents (0.01-0.1%)

Purification and storage optimization:

  • Buffer composition:

    • Optimization of pH and ionic strength

    • Addition of stabilizing agents (glycerol, arginine, proline)

    • Inclusion of specific metal ions required for structural integrity

  • Additives for long-term storage:

    • Cryoprotectants (10-20% glycerol, sucrose)

    • Reducing agents if appropriate (DTT, β-mercaptoethanol)

    • Protease inhibitors for sensitive proteins

  • Physical stabilization methods:

    • Lyophilization with appropriate excipients

    • Spray-drying for certain applications

    • Immobilization on solid supports

For cobS specifically, studies with other cobalamin-binding proteins suggest that maintaining appropriate cofactor concentration is critical for stability, as captured in structural studies of cobalamin-dependent enzymes .

What spectroscopic methods are most informative for characterizing recombinant cobS structure and function?

Several spectroscopic methods provide valuable insights into recombinant cobS structure and function:

UV-visible spectroscopy:

  • Particularly informative for cobS due to its interaction with cobalamin

  • Characteristic absorption bands of cobalamin (350-550 nm) change upon binding

  • Can monitor cobalt redox state changes during enzymatic reactions

  • Allows real-time kinetic analysis of cobS activity

Circular dichroism (CD) spectroscopy:

  • Far-UV CD (190-250 nm) provides quantitative assessment of secondary structure elements

  • Near-UV CD (250-350 nm) reports on tertiary structure and aromatic amino acid environments

  • Thermal denaturation studies can determine stability parameters (Tm)

  • Similar approaches have been used successfully with other recombinant proteins from B. brevis

Fluorescence spectroscopy:

  • Intrinsic tryptophan fluorescence monitors tertiary structure changes

  • FRET (Förster Resonance Energy Transfer) can measure distances between labeled sites

  • Binding of fluorescent substrate analogs can provide direct activity assessment

  • Time-resolved fluorescence may detect conformational dynamics

Vibrational spectroscopy:

  • FTIR (Fourier Transform Infrared) spectroscopy provides complementary secondary structure information

  • Raman spectroscopy offers advantages for aqueous samples and can detect metal-ligand interactions

  • Resonance Raman can specifically enhance signals from cobalamin when bound to cobS

NMR spectroscopy:

  • 1H-15N HSQC experiments can provide "fingerprints" of protein folding

  • Selective isotopic labeling can probe specific regions of interest

  • Metal-specific NMR (59Co) may provide direct information about cobalt environment in cobS

For comprehensive characterization, multiple spectroscopic techniques should be combined to provide complementary structural and functional information.

How can researchers use mass spectrometry to characterize recombinant cobS and its interactions?

Mass spectrometry offers powerful approaches for characterizing recombinant cobS and its interactions:

Protein identification and integrity:

  • Intact mass analysis:

    • Confirms molecular weight of the full protein

    • Verifies signal peptide cleavage

    • Detects post-translational modifications

    • Typical accuracy: ±0.01% for proteins around 40-60 kDa

  • Peptide mapping:

    • Digestion with specific proteases followed by LC-MS/MS

    • Provides sequence coverage verification

    • Identifies modifications at specific residues

    • Can achieve >95% sequence coverage under optimal conditions

Structural characterization:

  • Hydrogen-deuterium exchange (HDX-MS):

    • Maps solvent-accessible regions

    • Monitors conformational changes upon ligand binding

    • Identifies structural dynamics during catalysis

    • Spatial resolution to ~5-10 amino acids

  • Chemical cross-linking:

    • Identifies proximities between specific residues

    • Maps protein-protein interaction interfaces

    • Can be combined with molecular modeling

    • Distance constraints typically 5-30 Å depending on crosslinker

  • Native MS:

    • Preserves non-covalent complexes

    • Determines stoichiometry of protein complexes

    • Monitors ligand binding in real-time

    • Can detect heterogeneity in complex formation

Functional analysis:

  • Activity-based protein profiling:

    • Uses active site-directed probes

    • Confirms catalytic competence

    • Can be performed in complex mixtures

  • Targeted metabolomics:

    • Monitors substrate consumption and product formation

    • Detects pathway intermediates

    • Quantifies reaction rates and efficiencies

These MS approaches provide comprehensive characterization of recombinant cobS from primary structure verification to complex functional analyses.

What crystallization strategies are most promising for structural studies of recombinant cobS?

Promising crystallization strategies for structural studies of recombinant cobS include:

Sample preparation:

  • Protein engineering approaches:

    • Surface entropy reduction (replacing high entropy residues like Lys/Glu with Ala)

    • Removal of flexible regions identified by limited proteolysis

    • Creation of fusion proteins with well-crystallizing partners (e.g., T4 lysozyme)

  • Homogeneity optimization:

    • Size-exclusion chromatography immediately before crystallization

    • Dynamic light scattering to confirm monodispersity (Pd <15%)

    • Thermal stability screening to identify optimal buffer conditions

Crystallization approaches:

  • Traditional methods:

    • Vapor diffusion (hanging/sitting drop) with sparse matrix screens

    • Batch crystallization under oil for slow equilibration

    • Free interface diffusion for screening concentration gradients

  • Advanced techniques:

    • Lipidic cubic phase for membrane-associated variants

    • Microseeding to control nucleation

    • Counter-diffusion in capillaries for gradient formation

    • Microgravity crystallization for proteins recalcitrant to Earth-based methods

  • Additive strategies:

    • Co-crystallization with substrates, products, or inhibitors

    • Inclusion of specific metal ions, particularly cobalt

    • Use of chemical chaperones (e.g., glycerol, MPD)

    • Antibody-mediated crystallization using conformation-specific Fab fragments

In crystallo approaches:

  • Capturing cobalamin loading directly in the crystal, similar to approaches used with other cobalamin-binding proteins

  • Reaction initiation in crystals using photoactivation or chemical triggers

  • Temperature-controlled studies to capture different conformational states

Recent successes with structurally related cobalamin-dependent enzymes suggest that stability-enhancing mutations combined with ligand co-crystallization offer promising avenues for cobS structural determination .

How can recombinant cobS be used to study the mechanism of cobalamin biosynthesis?

Recombinant cobS provides powerful tools for investigating cobalamin biosynthesis mechanisms:

Enzyme kinetics and mechanism:

  • Steady-state kinetic analysis:

    • Determination of kinetic parameters (Km, kcat, kcat/Km)

    • Inhibition studies to identify regulatory mechanisms

    • pH and temperature dependence to determine optimal conditions

  • Pre-steady-state kinetics:

    • Stopped-flow spectroscopy to monitor rapid reaction phases

    • Identification of reaction intermediates

    • Determination of rate-limiting steps

  • Isotope effects:

    • Use of deuterium or 13C-labeled substrates

    • Elucidation of chemical mechanism

    • Identification of transition state structures

Structure-function relationships:

  • Site-directed mutagenesis:

    • Systematic modification of conserved residues

    • Catalytic mechanism investigation

    • Substrate binding site mapping

  • Domain swapping:

    • Exchange of domains between cobS from different organisms

    • Identification of species-specific functional adaptations

    • Engineering of chimeric enzymes with novel properties

  • Structural studies:

    • X-ray crystallography of cobS in different functional states

    • Cryo-EM analysis of the complete CobNST complex

    • NMR studies of dynamic regions

Pathway reconstitution:

  • In vitro reconstitution:

    • Assembly of partial or complete pathways using purified components

    • Identification of metabolic bottlenecks

    • Study of metabolite channeling between enzymes

  • Synthetic biology approaches:

    • Minimal pathways constructed from well-characterized components

    • Pathway optimization through directed evolution

    • Creation of artificial metabolic modules

These approaches contribute to a mechanistic understanding of cobalamin biosynthesis, potentially leading to biotechnological applications in vitamin B12 production.

What are the potential applications of engineered cobS variants in synthetic biology?

Engineered cobS variants offer diverse applications in synthetic biology:

Pathway engineering:

  • Enhanced cobalamin production:

    • Variants with improved catalytic efficiency

    • Reduced feedback inhibition sensitivity

    • Altered substrate specificity for modified cobalamins

  • Biosensor development:

    • cobS-based detection systems for pathway intermediates

    • Real-time monitoring of cobalamin biosynthesis

    • Environmental sensors for cobalt or related compounds

  • Artificial metabolic modules:

    • Creation of simplified cobalamin biosynthetic pathways

    • Integration with other metabolic modules

    • Development of orthogonal cofactor synthesis systems

Protein engineering applications:

  • Novel catalytic functions:

    • Engineering cobS to accept non-natural substrates

    • Creation of hybrid enzymes with expanded capabilities

    • Development of cobS variants that function in extreme conditions

  • Structural scaffolds:

    • Using cobS as a structural framework for novel enzyme assembly

    • Creation of artificial enzyme complexes with enhanced catalytic efficiency

    • Development of protein-based materials with cobalamin-dependent properties

  • Therapeutic applications:

    • Engineered cobS variants for detoxification of harmful compounds

    • Development of enzyme replacement therapies

    • Creation of delivery systems for cobalamin-conjugated drugs

Biotechnology applications:

  • Biocatalysis:

    • Use of cobS in multi-enzyme cascades for complex chemical synthesis

    • Development of immobilized cobS systems for continuous processes

    • Creation of whole-cell biocatalysts with enhanced cobS activity

  • Diagnostic tools:

    • Development of cobS-based assays for cobalamin pathway disorders

    • Creation of detection systems for specific metabolites

    • Use in environmental monitoring applications

These applications represent the potential for cobS to contribute to both fundamental research and applied biotechnology in the emerging field of synthetic biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.