Recombinant Brevibacillus brevis Energy-coupling factor transporter transmembrane protein EcfT (ecfT)

Shipped with Ice Packs
In Stock

Description

Introduction to EcfT

The energy-coupling factor (ECF) transporters are ATP-dependent transmembrane proteins critical for micronutrient uptake in prokaryotes. EcfT, the transmembrane component of these transporters, serves as a structural and functional bridge between the cytosolic ATPases (EcfA and EcfA’) and the substrate-binding S-component (EcfS). In Brevibacillus brevis, a soil-dwelling Gram-positive bacterium, EcfT is integral to the uptake of vitamins and trace elements, supporting its role in agriculture and microbial interactions .

Functional Role in ECF Transporter Complex

EcfT coordinates ATP hydrolysis and substrate translocation through its interactions with EcfA/A’ and EcfS. The quaternary structure of the ECF transporter is typically 1:1:1:1 (EcfA:EcfA’:EcfT:EcfS) .

ComponentRole in ComplexInteraction with EcfTCitations
EcfA/EcfA’ATP hydrolysis-driven conformational changesCoupling helices link EcfT to ATPase domains
EcfSSubstrate binding and translocationStabilized by EcfT’s transmembrane helices

Mechanistic Model:

  1. Substrate Binding: EcfS binds extracellular nutrients (e.g., folate, pantothenate) with high affinity.

  2. ATP Hydrolysis: EcfA/A’ hydrolyze ATP, inducing conformational changes in EcfT.

  3. Translocation: EcfT’s dynamic helices reorient EcfS, releasing substrate into the cytoplasm .

Applications in Biotechnology

  • Vitamin Uptake Modulation: EcfT’s role in nutrient acquisition makes it a target for enhancing microbial fitness in agricultural biotechnology .

  • Antibiotic Development: Inhibiting EcfT in pathogens (e.g., L. delbrueckii) could disrupt essential nutrient uptake .

Data Tables

Recombinant Brevibacillus brevis EcfT is a pivotal component of ECF transporters, enabling nutrient acquisition through its dynamic structure and multifaceted interactions. Its role in coupling ATP hydrolysis to substrate translocation positions it as a critical target for antimicrobial and biotechnological applications. Further studies are needed to elucidate its precise mechanism of action and exploit its potential in therapeutic and agricultural contexts.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipment is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ecfT; BBR47_02520; Energy-coupling factor transporter transmembrane protein EcfT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-265
Protein Length
full length protein
Species
Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Target Names
ecfT
Target Protein Sequence
MLQNIAIGQYVPGQSFLHRADPRSKLLFIILFATLIFLANNTVTYAILIGFTLYAALLSR LSLSYILKSLKPVWILILFTVVLHIFITKGGTVYFQWGWFTVEEQGVRQAIFISLRLGLL ILISSLLTLTTSPIDLTEGLERLLGPLGKIGIPVHDIALMMSIALRFIPTLMEETDKIIK AQTARGANFTSGSLVRRAKNLIPIAIPLFVSAFRRAEELALAMEARGYRGGVGRTRLNKL TFTWRDGIVAVVSVILVIVIGWWRT
Uniprot No.

Target Background

Function
EcfT (ecfT) is the transmembrane (T) component of an energy-coupling factor (ECF) ABC-transporter complex. Unlike traditional ABC transporters, this ECF transporter provides the energy required for the transport of various substrates.
Database Links
Protein Families
Energy-coupling factor EcfT family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does EcfT integrate with other components of the Energy-Coupling Factor transport system?

EcfT serves as the transmembrane scaffold of the ECF transporter complex, interacting with both the substrate-binding S-component and the energizing ATPase components (EcfA and EcfA'). In functional ECF transporters, EcfT mediates the coupling between ATP hydrolysis and substrate transport by undergoing conformational changes that facilitate the toppling of the S-component during the transport cycle.

To study these interactions experimentally, researchers should employ:

  • Co-immunoprecipitation assays with tagged EcfT to identify binding partners

  • FRET or crosslinking studies to detect proximity between components

  • Reconstitution of the complete ECF complex in liposomes to assess functional interactions

  • Mutational analysis of conserved residues at predicted interaction interfaces

What conserved domains are present in the EcfT protein and what is their functional significance?

The EcfT protein contains several conserved domains that are crucial for its function:

  • Transmembrane helices: Multiple hydrophobic segments that span the membrane

  • Coupling helices: Interact with the ATPase subunits to couple ATP hydrolysis to conformational changes

  • S-component binding regions: Facilitate interaction with the substrate-binding component

To identify and characterize these domains, researchers should:

  • Perform domain prediction using bioinformatics tools like TMHMM, Phobius, or CCTOP

  • Conduct alanine-scanning mutagenesis of conserved residues

  • Express truncated versions of the protein to determine minimal functional regions

  • Compare sequences across different bacterial species to identify highly conserved motifs

What expression systems are optimal for recombinant Brevibacillus brevis EcfT production?

For efficient expression of functional Brevibacillus brevis EcfT protein:

Expression SystemAdvantagesDisadvantagesYield
E. coli BL21(DE3)High yield, easy genetic manipulationPotential inclusion body formationModerate-High
E. coli C41/C43Specialized for membrane proteinsLower yield than BL21Moderate
Cell-free systemsAvoids toxicity issuesExpensive, lower yieldLow-Moderate
Yeast (P. pastoris)Post-translational modifications, proper foldingLonger expression timeModerate

Based on the search results, E. coli expression systems have been successfully used to produce recombinant EcfT protein with N-terminal His-tags . When expressing this membrane protein:

  • Use low induction temperatures (16-25°C)

  • Consider mild inducers (0.1-0.5 mM IPTG)

  • Include membrane-stabilizing additives like glycerol in growth media

  • Monitor expression through Western blotting rather than SDS-PAGE alone

What purification strategies yield the highest purity and stability of functional EcfT protein?

Purification of EcfT requires specialized approaches due to its hydrophobic nature:

  • Solubilization:

    • Test multiple detergents (DDM, LMNG, LDAO)

    • Optimize detergent concentration (typically 1-2% for extraction, 2-3× CMC for purification)

    • Include stabilizers (glycerol 10-20%, specific lipids)

  • Purification steps:

    • IMAC using Ni-NTA for His-tagged protein

    • Size exclusion chromatography to remove aggregates

    • Consider ion exchange chromatography as a polishing step

  • Quality assessment:

    • SDS-PAGE (>90% purity is typically achievable)

    • Size-exclusion chromatography to verify monodispersity

    • Circular dichroism to confirm secondary structure integrity

Storage recommendations include maintaining the purified protein in a buffer containing 6% trehalose at pH 8.0, and avoiding repeated freeze-thaw cycles by preparing aliquots for single use .

How can researchers effectively reconstitute purified EcfT into membrane mimetics for functional studies?

For functional characterization of EcfT, proper reconstitution into membrane environments is crucial:

  • Liposome reconstitution:

    • Use E. coli polar lipids or defined synthetic mixtures

    • Detergent removal via Bio-Beads, dialysis, or gel filtration

    • Verify incorporation using freeze-fracture electron microscopy

    • Assess protein orientation using protease protection assays

  • Nanodiscs:

    • Select appropriate MSP variants based on EcfT size

    • Optimize protein:MSP:lipid ratios (typically 1:10:600-800)

    • Purify assembled nanodiscs by size exclusion chromatography

  • Functional validation:

    • ATPase activity assays using coupled enzyme systems

    • Transport assays with fluorescent substrate analogs

    • Binding studies using microscale thermophoresis or ITC

What experimental approaches are most effective for studying EcfT interaction with other ECF transporter components?

To investigate the interactions between EcfT and other ECF components:

  • Structural studies:

    • X-ray crystallography of the complete complex

    • Cryo-EM for visualization of different conformational states

    • Hydrogen-deuterium exchange mass spectrometry to map interaction interfaces

  • Biochemical approaches:

    • Pull-down assays with differentially tagged components

    • Surface plasmon resonance to measure binding kinetics

    • Crosslinking mass spectrometry to identify proximity relationships

  • Biophysical methods:

    • FRET/BRET to monitor real-time interactions in native environments

    • Analytical ultracentrifugation to determine complex stoichiometry

    • Native mass spectrometry for intact complex analysis

When designing these experiments, researchers should consider:

  • Using genomic context information from Brevibacillus brevis to identify all potential interacting partners

  • Including appropriate negative controls (non-interacting membrane proteins)

  • Validating interactions through multiple complementary techniques

How can researchers design effective mutational studies to probe EcfT function?

Systematic mutational analysis of EcfT should include:

  • Target selection strategy:

    • Conserved residues identified through multiple sequence alignment

    • Residues predicted to be at component interfaces

    • Charged or polar residues within transmembrane regions

    • Residues implicated in conformational changes

  • Mutation types:

    • Alanine scanning for general functional assessment

    • Conservative substitutions to probe specific interactions

    • Cysteine scanning for accessibility and crosslinking studies

    • Introduction of fluorescent probe attachment sites

  • Functional assays:

    • Growth complementation in deletion strains

    • Transport activity measurements in reconstituted systems

    • ATP hydrolysis coupling efficiency

    • Component assembly verification

  • Data analysis approach:

    • Classification of mutations (assembly defective vs. transport defective)

    • Mapping of critical residues onto structural models

    • Correlation between conservation and functional importance

What methods are recommended for studying the topology and membrane insertion of EcfT?

To determine membrane topology and insertion mechanisms:

  • Experimental topology mapping:

    • PhoA/LacZ fusion analysis at various positions

    • SCAM (substituted cysteine accessibility method)

    • Protease protection assays with purified protein in liposomes

    • GFP-based reporter systems for in vivo analysis

  • Insertion mechanism studies:

    • In vitro translation in the presence of inverted membrane vesicles

    • Analysis of SRP-dependence using reconstituted systems

    • Crosslinking to translocon components during synthesis

    • Pulse-chase experiments to monitor membrane integration kinetics

  • Validation approaches:

    • Compare experimental results with topology prediction algorithms

    • Use distance constraints from crosslinking for molecular modeling

    • Accessibility studies with impermeant labels

How does the evolutionary conservation of EcfT compare across different bacterial species?

The evolutionary analysis of EcfT proteins should include:

  • Phylogenetic analysis workflow:

    • Collect homologous sequences from diverse bacterial phyla

    • Perform multiple sequence alignment with membrane protein-specific algorithms

    • Generate phylogenetic trees using maximum likelihood methods

    • Analyze conservation patterns in context of known ECF transporter classes

  • Structure-function correlation:

    • Map conserved residues onto structural models

    • Identify co-evolving residues that may form functional networks

    • Compare conservation patterns between different ECF transporter subfamilies

  • Genomic context analysis:

    • Examine operon structures containing ecfT genes

    • Identify co-occurrence patterns with specific S-components

    • Analyze horizontal gene transfer events

What computational approaches are most valuable for predicting EcfT structure and dynamics?

For computational analysis of EcfT:

  • Structure prediction:

    • AlphaFold2 or RoseTTAFold for initial model generation

    • Molecular dynamics refinement in explicit membrane environments

    • Model validation using evolutionary constraints

    • Integration of experimental distance constraints where available

  • Dynamics simulation:

    • All-atom MD simulations (100ns-1μs) to identify flexible regions

    • Coarse-grained simulations for longer timescale events

    • Targeted MD to explore conformational transitions

    • Normal mode analysis to identify potential transport-related motions

  • Functional analysis:

    • Electrostatic surface mapping to identify potential interaction sites

    • Molecular docking with ATP and S-components

    • Network analysis to identify allosteric communication pathways

    • Free energy calculations for substrate translocation events

How can researchers integrate structural and functional data to develop mechanistic models of EcfT-mediated transport?

To develop comprehensive mechanistic models:

  • Data integration strategy:

    • Compile all available structural snapshots from crystallography/cryo-EM

    • Map functional data from mutational studies onto structures

    • Incorporate dynamic information from spectroscopic methods

    • Use crosslinking data to establish distance constraints

  • Model development approach:

    • Construct state transition diagrams with defined conformational states

    • Develop kinetic models that incorporate ATP binding/hydrolysis steps

    • Use molecular dynamics to identify transition pathways between states

    • Validate predictions with targeted experiments

  • Experimental validation:

    • Design mutations predicted to block specific conformational transitions

    • Use EPR or FRET to measure distances between labeled positions

    • Perform time-resolved experiments to capture intermediate states

    • Test predictions about rate-limiting steps through kinetic measurements

What are common challenges in recombinant EcfT expression and how can they be addressed?

Researchers frequently encounter these challenges when working with EcfT:

ChallengePossible CausesSolutions
Low expressionToxicity to host, rare codonsUse C41/C43 strains, tune expression conditions, codon-optimize sequence
Inclusion body formationRapid expression, improper foldingLower induction temperature, use milder inducers, add folding enhancers
Aggregation during purificationInadequate detergent, improper bufferScreen multiple detergents, include glycerol and specific lipids
Loss of activityDelipidation, conformational changesAdd lipids during purification, stabilize with substrate analogs
Heterogeneous samplesPartial proteolysis, multiple conformationsAdd protease inhibitors, optimize buffer conditions, use SEC-MALS

Based on the product information, incorporating 5-50% glycerol in the storage buffer and maintaining the protein at -20°C/-80°C in aliquots can help maintain stability and avoid repeated freeze-thaw cycles .

What controls and validation steps are essential when studying EcfT-mediated transport in reconstituted systems?

When studying EcfT function in reconstituted systems:

  • Essential controls:

    • Inactive mutants (e.g., Walker A/B mutations in ATPase components)

    • Reconstitution without protein to measure background leakage

    • Competitive inhibition with excess unlabeled substrate

    • Transport in the absence of ATP or with non-hydrolyzable analogs

  • System validation:

    • Verify protein orientation using protease protection assays

    • Confirm complex assembly through co-purification or crosslinking

    • Measure ATP hydrolysis rates in parallel with transport

    • Assess lipid composition and fluidity effects

  • Data quality assessment:

    • Perform time-course measurements to establish initial rates

    • Verify reproducibility across different protein preparations

    • Test substrate concentration dependence for kinetic parameters

    • Control for potential artifacts from fluorescent substrate analogs

How can researchers overcome challenges in structural studies of EcfT and the ECF complex?

For structural characterization of this challenging membrane protein complex:

  • Crystallization strategies:

    • Screen detergent/lipid combinations systematically

    • Use lipidic cubic phase crystallization

    • Consider co-crystallization with antibody fragments or nanobodies

    • Introduce thermostabilizing mutations based on computational predictions

  • Cryo-EM approaches:

    • Optimize grid preparation with different support films

    • Use amphipols or nanodiscs instead of detergent micelles

    • Apply focused classification to deal with conformational heterogeneity

    • Consider cross-linking to stabilize specific conformational states

  • Alternative structural methods:

    • SANS/SAXS for low-resolution envelope determination

    • NMR for specific domain structure and dynamics

    • Mass photometry for complex stoichiometry verification

    • HDX-MS to map solvent-accessible regions and conformational changes

How can synthetic biology approaches be used to engineer EcfT for novel functions?

Emerging synthetic biology applications for EcfT include:

  • Engineering strategy:

    • Domain swapping between EcfT variants with different specificities

    • Directed evolution to alter substrate specificity or improve stability

    • Construction of chimeric transporters with novel properties

    • Minimal ECF transporter design with reduced complexity

  • Potential applications:

    • Development of biosensors using ECF transport-coupled reporters

    • Engineering microbes with enhanced nutrient uptake capabilities

    • Creating bacterial strains with resistance to specific antimicrobials

    • Designing artificial transport systems for biotechnology applications

  • Experimental design considerations:

    • High-throughput screening methods for transporter function

    • In vivo selection strategies for evolved transporters

    • Modular design principles for plug-and-play component exchange

    • Computational design of interface modifications

What is the current understanding of EcfT's role in antimicrobial resistance and bacterial physiology?

The role of EcfT in broader bacterial physiology:

  • Metabolic integration:

    • Connection between ECF transport and cellular energy status

    • Regulation of EcfT expression under nutrient limitation

    • Metabolic modeling of ECF transporter contribution to fitness

  • Antimicrobial considerations:

    • Potential role in importing or exporting antimicrobial compounds

    • Relationship to Brevibacillus species' production of antimicrobial peptides

    • Investigation of EcfT as a potential antimicrobial target

  • Research approaches:

    • Transcriptomic analysis under various stress conditions

    • Phenotypic characterization of ecfT deletion strains

    • Metabolomic profiling to identify transported substrates

    • In vivo imaging of labeled EcfT to detect localization patterns

Brevibacillus species produce numerous antimicrobial peptides including edeine, gramicidin, tyrocidine, and others that may require specialized transport systems for secretion or resistance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.