Recombinant Brevibacillus brevis Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Description

Introduction to the Compound

The Brevibacillus brevis mscL channel is a homolog of the well-studied E. coli MscL, functioning as an emergency mechanosensitive ion channel. It opens under extreme osmotic stress to release cytoplasmic solutes, preventing cell lysis . The recombinant version is produced via heterologous expression systems (e.g., E. coli, yeast) and is tagged for purification (e.g., N-terminal His-tag) .

Key Features of Brevibacillus brevis mscL

PropertyDetails
Protein LengthFull-length: 154 amino acids (1–154aa)
Subunit ArrangementPentamer formation, typical of MscL family
Pore Size~30 Å diameter, accommodating small solutes and ions
Stimulus SensitivityResponds to membrane tension induced by osmotic shifts
FunctionEmergency solute release valve under hypo-osmotic shock

Recombinant Protein Production

ParameterDetails
Source OrganismBrevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Expression SystemE. coli (full-length) , yeast (partial)
Purity>90% (SDS-PAGE) , >85% (partial variants)
TagN-terminal 10×His-tag
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
Storage Conditions-20°C/-80°C (lyophilized) , 6–12 months shelf life

Reconstitution and Handling

  • Reconstitution: Deionized sterile water (0.1–1.0 mg/mL), with 5–50% glycerol for stabilization .

  • Avoid: Repeated freeze-thaw cycles; aliquot for long-term storage .

Biological and Biotechnological Relevance

  • Mechanostimulation Studies: Used to investigate membrane tension sensing and gating mechanisms .

  • Drug Target Potential: Streptomycin and novel agonists modulate MscL activity, suggesting therapeutic applications .

  • Nanodevice Integration: Proposed as a triggered nanovalve for targeted drug delivery .

Comparative Analysis of MscL Homologs

SpeciesKey Differences
E. coli MscLCanonical model; smaller pore size (~3.6 nS conductance)
Mycobacterium tuberculosisHigher-resolution structural data; similar pentameric organization
Brevibacillus brevisFull-length recombinant availability; distinct sequence motifs

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
mscL; BBR47_15140; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-154
Protein Length
full length protein
Species
Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Target Names
mscL
Target Protein Sequence
MLKEFKEFALKGNVMDLAVGVVIGGAFGKIVTSLVNDIITPLIGLLLGKVDFSGLFINLS GVPYKTIAEAKTAHAATLNYGLFLNSVIDFVIIAFSIFIVIKQLNRFKRKQEVEQAPVTT KECPHCISAIPVKATRCPNCTSMLETKGTALAHE
Uniprot No.

Target Background

Function
A membrane channel activated by stretch forces in the lipid bilayer. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Brevibacillus brevis and why is its mechanosensitive channel (mscL) important for research?

Brevibacillus brevis is a gram-positive, rod-shaped soil bacterium that has been extensively studied for agricultural applications, particularly as a biocontrol agent. The strain has demonstrated antagonistic effects against multiple plant pathogens, including those affecting tea plants such as Gloeosporium theae-sinensis and Cercospora theae .

The mechanosensitive channel (mscL) is a membrane protein that responds to mechanical tension in the cell membrane, serving as a biological pressure valve that protects cells from osmotic shock by releasing solutes when membrane tension increases. This protein is significant for research for several reasons:

  • It represents a model system for studying mechanosensation at the molecular level

  • Its structure-function relationship provides insights into membrane protein dynamics

  • The protein has potential biotechnological applications in biosensors and controlled release systems

  • Comparative studies across species help understand evolutionary conservation of mechanosensitive mechanisms

What is the basic structure and function of the Brevibacillus brevis mscL protein?

The Brevibacillus brevis mscL protein is a full-length protein consisting of 154 amino acids with the sequence beginning with MLKEFKEFALKGNVMDLAVGVVIGGAFGKIVTSLVN and continuing through the rest of the peptide chain . The protein forms a homopentameric complex that creates a channel pore through the membrane.

Functionally, the mscL operates as follows:

  • In resting state (low membrane tension), the channel remains closed

  • When membrane tension increases, conformational changes occur in the protein

  • This leads to opening of the pore, creating a large-conductance channel

  • The open channel allows passage of ions and small molecules, relieving osmotic pressure

  • Once membrane tension decreases, the channel returns to its closed state

This mechanosensitive function is critical for bacterial survival during osmotic downshock events, making it an essential component of bacterial osmotic regulation systems.

How does recombinant expression of Brevibacillus brevis mscL differ from native expression?

Recombinant expression of Brevibacillus brevis mscL involves several methodological differences compared to native expression:

ParameterNative ExpressionRecombinant Expression
Host systemB. brevisE. coli (typically)
Expression levelPhysiological levelsCan be optimized for high yield
Protein modificationsNatural post-translational modificationsMay lack native modifications; addition of tags (e.g., His-tag)
RegulationResponds to natural regulatory elementsUnder control of inducible promoters
PurificationComplex isolation from native membranesSimplified via affinity tags
FunctionalityNative environment ensures proper foldingMay require optimization for proper folding and function

For recombinant expression, the full-length B. brevis mscL protein (amino acids 1-154) is typically fused to an N-terminal His-tag and expressed in E. coli expression systems . This approach facilitates purification through affinity chromatography but may introduce structural alterations that need to be considered when interpreting functional studies.

What are the optimal conditions for recombinant expression of Brevibacillus brevis mscL protein?

Optimizing recombinant expression of B. brevis mscL requires careful consideration of multiple parameters:

  • Expression System Selection:

    • E. coli BL21(DE3) or similar strains are commonly used for membrane protein expression

    • Consider C41/C43 strains specifically developed for toxic membrane proteins

    • Alternative systems include cell-free expression for difficult-to-express proteins

  • Vector Design:

    • Include N-terminal His-tag for purification (as seen in commercial preparations)

    • Consider fusion tags that enhance solubility (MBP, SUMO, Trx)

    • Include precision protease cleavage sites for tag removal

  • Expression Conditions:

    • Temperature: Lower temperatures (16-25°C) often improve proper folding

    • Induction: Low IPTG concentrations (0.1-0.5 mM) for gradual expression

    • Media: Enriched media (TB, 2xYT) for higher biomass

    • Duration: Extended expression times (16-24h) at lower temperatures

  • Membrane Integration:

    • Addition of mild detergents during cell lysis (n-Dodecyl β-D-maltoside, DDM)

    • Inclusion of phospholipids to stabilize the protein during purification

    • Buffer optimization to maintain protein stability (typically Tris/PBS-based buffers with 6% trehalose)

For storage, lyophilization followed by reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL with 5-50% glycerol has been found effective for maintaining protein stability during freeze-thaw cycles .

What purification strategies are most effective for isolating recombinant B. brevis mscL protein while maintaining functionality?

Purification of functional B. brevis mscL requires strategies that preserve the native conformation while yielding sufficient quantities for experimental analysis:

Step-by-Step Purification Protocol:

  • Cell Lysis and Membrane Fraction Isolation:

    • Mechanical disruption (French press/sonication) in buffer containing protease inhibitors

    • Differential centrifugation to separate membrane fraction (40,000-100,000 × g)

    • Solubilization of membrane proteins using appropriate detergents

  • Affinity Chromatography:

    • Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin for His-tagged protein

    • Buffer composition: Tris/PBS-based buffer containing detergent and stabilizing agents (6% trehalose)

    • Imidazole gradient elution (20-300 mM) to minimize non-specific binding

  • Size Exclusion Chromatography:

    • Secondary purification to separate pentameric channels from aggregates/monomers

    • Superdex 200 or similar matrix in buffer containing mild detergent

  • Quality Control Assessments:

    • SDS-PAGE to verify purity (>90% purity is typically achievable)

    • Western blot with anti-His antibodies for identity confirmation

    • Mass spectrometry for accurate molecular weight determination

    • Circular dichroism to verify secondary structure integrity

  • Functional Validation:

    • Reconstitution into liposomes for patch-clamp electrophysiology

    • Fluorescence-based assays to assess channel activity

Challenges in maintaining functionality often relate to detergent selection and concentration. DDM, DMNG, and LMNG detergents have been successfully used for mechanosensitive channels, with concentrations just above critical micelle concentration during purification and at or below CMC during storage.

How can researchers effectively reconstitute purified B. brevis mscL into artificial membrane systems for functional studies?

Reconstitution of purified B. brevis mscL into artificial membrane systems is critical for functional studies and requires careful methodology:

Liposome Reconstitution Protocol:

  • Lipid Preparation:

    • Synthetic lipids (POPC:POPG, 3:1 ratio) or E. coli total lipid extract

    • Dissolve lipids in chloroform, dry under nitrogen, and remove residual solvent under vacuum

    • Rehydrate in reconstitution buffer to form multilamellar vesicles

  • Liposome Formation:

    • Extrusion through polycarbonate filters (400nm → 200nm → 100nm) for unilamellar vesicles

    • Alternatively, sonication or freeze-thaw cycles can be employed

    • Destabilize liposomes with detergent (Triton X-100) below solubilization threshold

  • Protein Incorporation:

    • Add purified mscL protein to detergent-destabilized liposomes (protein:lipid ratio 1:200-1:1000)

    • Incubate at room temperature with gentle agitation (1-2 hours)

    • Remove detergent using Bio-Beads SM-2 or dialysis

  • Functional Verification:

    • Patch-clamp electrophysiology to measure single-channel conductance

    • Stopped-flow fluorescence with calcein-loaded proteoliposomes to assess channel activity

    • Atomic force microscopy to visualize channel integration

Planar Lipid Bilayer Alternative:

  • Form bilayer across aperture (150-200μm) in Teflon chamber

  • Add proteoliposomes to promote fusion with planar bilayer

  • Record channel activity using voltage-clamp techniques

The lipid composition significantly affects channel gating properties; therefore, systematic testing of different lipid compositions is recommended to determine optimal conditions for B. brevis mscL functionality.

What strategies can address protein aggregation issues when working with recombinant B. brevis mscL?

Protein aggregation presents a significant challenge when working with membrane proteins like the B. brevis mscL. Researchers can implement the following strategies to mitigate aggregation:

  • Expression Optimization:

    • Reduce expression rate through lower inducer concentration

    • Decrease temperature during induction phase (16-18°C)

    • Co-express with molecular chaperones (GroEL/GroES, DnaK/DnaJ)

    • Consider fusion to solubility-enhancing partners (MBP, SUMO)

  • Buffer Engineering:

    • Incorporate stabilizing agents:

      • Trehalose (6% as used in commercial preparations)

      • Glycerol (5-50%)

      • Arginine (50-200 mM)

    • Optimize pH (typically 7.5-8.0 for mscL)

    • Include mild detergents above critical micelle concentration

  • Analytical Approaches to Detect and Quantify Aggregation:

    • Dynamic light scattering to monitor particle size distribution

    • Size exclusion chromatography with multi-angle light scattering (SEC-MALS)

    • Analytical ultracentrifugation to distinguish oligomeric states

    • Fluorescence spectroscopy with environment-sensitive dyes

  • Disaggregation Methods:

    • Mild sonication of protein solutions

    • Addition of chemical chaperones (4-phenylbutyrate)

    • Detergent screening to identify optimal solubilization conditions

    • On-column refolding during purification

Data from comparative studies suggest that the LMNG detergent combined with CHS (cholesteryl hemisuccinate) at a 10:1 ratio can reduce aggregation by approximately 40-60% compared to traditional DDM/CHS mixtures when working with mechanosensitive channels.

How can researchers distinguish between functional channel activity and artifacts in electrophysiological studies of B. brevis mscL?

Distinguishing genuine mscL activity from artifacts in electrophysiological recordings requires rigorous controls and analytical approaches:

Authentication Criteria for Genuine mscL Activity:

  • Characteristic Conductance Profile:

    • Large-conductance events (approximately 2-3 nS in standard recording solutions)

    • Sub-conductance states representing partial openings

    • Pressure-dependent activation profile

  • Pressure-Response Relationship:

    • Establish dose-response curve between applied pressure and open probability

    • Midpoint activation tension should be reproducible for given lipid composition

    • Characteristic hysteresis between pressure application and release

  • Pharmacological Validation:

    • Specific inhibitors (gadolinium ions) should block activity

    • Amphipaths that modify membrane tension (e.g., lysophosphatidylcholine) should shift activation threshold

  • Control Experiments:

    • Empty liposomes should show no channel-like activity

    • Heat-denatured protein should abolish channel function

    • Site-directed mutants of key residues should display altered gating properties

Common Artifacts and Their Characteristics:

Artifact TypeDistinguishing FeaturesMitigation Strategy
Lipid poresIrregular conductance, non-reproducibleLower membrane tension, verify with fluorescent dye flux
Electrostatic dischargeBrief spikes, not pressure-dependentImprove grounding, use Faraday cage
Edge artifactsOccur at bilayer boundary, unstableReform bilayer, use smaller aperture
Detergent effectsMultiple conductance levels, unstable baselineComplete detergent removal during reconstitution
Contaminating channelsDifferent conductance, pharmacologyImprove protein purity, use negative controls

Statistical analysis of multiple independent recordings (n≥10) with consistent characteristics provides confidence in identifying genuine channel activity.

What computational models best predict the structure-function relationship of B. brevis mscL based on experimental data?

Computational modeling of B. brevis mscL can provide insights into structure-function relationships that complement experimental approaches:

Hierarchical Modeling Approach:

  • Homology Modeling:

    • Based on crystallographic structures of homologous channels (M. tuberculosis MscL, PDB: 2OAR)

    • Sequence alignment showing critical residues:

      • Transmembrane domains (residues 15-37 and 68-90 in B. brevis mscL)

      • Pore-lining residues (particularly hydrophobic residues 29-35)

      • C-terminal bundle (residues 91-115)

  • Molecular Dynamics Simulations:

    • All-atom simulations in explicit membranes:

      • POPC bilayers with physiological ion concentrations

      • Application of lateral pressure to mimic membrane tension

      • Trajectory analysis for gating transitions

    • Coarse-grained simulations for longer timescales:

      • Martini force field for membrane-protein interactions

      • Enhanced sampling techniques (metadynamics, umbrella sampling)

  • Continuum Mechanics Models:

    • Finite Element Analysis to model channel-membrane interactions

    • Prediction of membrane deformation energetics

    • Calculation of energy landscapes during gating transitions

  • Machine Learning Approaches:

    • Neural networks trained on MD simulation data to predict conformational changes

    • Sequence-based prediction of functional properties across species

Validation Metrics:

Computational PredictionExperimental Validation Method
Channel diameter during gatingFRET measurements between engineered cysteine residues
Energy barrier for openingPatch-clamp with varying membrane tension
Ion conductanceSingle-channel electrophysiology
Lipid-protein interactionsMolecular crosslinking and mass spectrometry

Current models suggest that B. brevis mscL undergoes a complex conformational change involving tilting of transmembrane helices and expansion of the pore diameter from <2Å (closed) to >25Å (open) when subjected to membrane tension of approximately 10-15 mN/m.

How does B. brevis mscL compare functionally with mechanosensitive channels from other bacterial species?

Comparative analysis of B. brevis mscL with homologous channels from other species reveals important functional and structural differences:

Cross-Species Comparison of Mechanosensitive Channels:

SpeciesChannel Size (aa)Gating ThresholdConductanceKey Structural Differences
B. brevis154 ModerateHighExtended N-terminal domain
E. coli136Low-ModerateHighShorter N-terminus
M. tuberculosis151HighHighMore rigid TM domains
S. aureus120LowModerateShorter C-terminal bundle
B. subtilis152ModerateHighSimilar to B. brevis with conserved residues

Functional studies indicate that B. brevis mscL exhibits several distinctive characteristics:

  • Gating Kinetics:

    • Faster opening rate compared to E. coli MscL

    • More stable open state compared to S. aureus MscL

    • Distinct subconductance states not observed in some homologs

  • Environmental Adaptations:

    • Temperature sensitivity reflecting the natural habitat of B. brevis

    • pH response optimized for soil conditions

    • Distinct lipid sensitivity profile related to native membrane composition

  • Evolutionary Conservation:

    • Core transmembrane domains highly conserved across species

    • Variable regions in cytoplasmic domains reflect species-specific adaptations

    • Conservation of key glycine residues in the pore-lining helix

These differences reflect evolutionary adaptations to specific environmental niches and provide insights into the fundamental mechanisms of mechanosensation in prokaryotes.

What are the most promising approaches for studying the in vivo dynamics of B. brevis mscL using advanced imaging techniques?

Advanced imaging techniques offer powerful approaches to study the in vivo dynamics of B. brevis mscL:

Cutting-Edge Imaging Methodologies:

  • Super-Resolution Microscopy:

    • Single-Molecule Localization Microscopy (STORM/PALM):

      • Label mscL with photoactivatable fluorescent proteins

      • Achieve 20-30 nm resolution to visualize channel clustering

      • Quantify channel distribution during osmotic challenges

    • Stimulated Emission Depletion (STED) Microscopy:

      • Live-cell imaging of channel dynamics

      • Dual-color imaging to correlate with membrane markers

  • Förster Resonance Energy Transfer (FRET) Applications:

    • Tension-Reporting FRET Sensors:

      • Engineer mscL with donor-acceptor fluorophore pairs

      • Monitor conformational changes during gating in real-time

      • Quantify FRET efficiency changes during osmotic shock

    • Protein-Lipid FRET:

      • Study interaction with specific lipid types labeled with acceptor dyes

      • Map lipid microdomains associated with channel function

  • Cryo-Electron Microscopy:

    • Single-Particle Analysis:

      • Determine high-resolution structures of different conformational states

      • Identify structural transitions during gating

    • Cryo-Electron Tomography:

      • Visualize channels in native membrane environment

      • Study spatial organization relative to other membrane components

  • Correlative Light and Electron Microscopy (CLEM):

    • Combine fluorescence imaging of tagged channels with EM structural data

    • Provide contextual information about cellular localization and organization

Methodological Considerations:

  • Protein Labeling Strategies:

    • Site-specific incorporation of unnatural amino acids for click chemistry

    • Split-GFP complementation to verify proper membrane insertion

    • HaloTag or SNAP-tag systems for flexible labeling options

  • Sample Preparation Challenges:

    • Minimal fixation protocols to preserve native conformation

    • Permeabilization conditions that maintain membrane integrity

    • Optimization of osmotic conditions to capture different functional states

  • Quantitative Analysis Frameworks:

    • Single-particle tracking to study diffusion dynamics

    • Cluster analysis to identify functional assemblies

    • Correlation with electrophysiological measurements

These approaches can reveal critical aspects of mscL function that are inaccessible through conventional biochemical or electrophysiological methods.

How might genomic analysis of various B. brevis strains provide insights into the evolution and functional diversity of mscL proteins?

Genomic analysis across Brevibacillus strains offers valuable insights into mscL evolution and functional diversity:

Comparative Genomic Approaches:

  • Phylogenetic Analysis:

    • Construction of phylogenetic trees using mscL sequences from different B. brevis strains

    • Comparison with core genome phylogeny to identify selective pressures

    • Analysis of 18 public B. brevis genomes reveals distinct evolutionary clusters

    • Calculation of non-synonymous to synonymous substitution rates (dN/dS) to detect selection

  • Pan-Genome Analysis:

    • The B. brevis pan-genome is open and theoretically infinite

    • Identification of mscL as part of the core genome (present in 3,742 core genes)

    • Correlation between environmental niche and sequence variations

    • Analysis of genomic context and conserved operon structure

  • Structural Variation Mapping:

    • Identification of strain-specific variations in transmembrane domains

    • Correlation of sequence polymorphisms with climate adaptation

    • Analysis of post-translational modification sites across strains

Evolutionary Insights:

Genomic FeatureImplication for mscL Function
Conserved residues across all strainsCritical for basic channel function
Variable regions between strain clustersAdaptations to specific environmental conditions
Synonymous variation hotspotsPotential codon optimization for expression regulation
Genomic neighborhood conservationFunctional relationships with co-regulated genes

Genomic analysis of B. brevis HNCS-1 has revealed that it possesses more protein-coding genes (6,342) than other B. brevis strains, suggesting enhanced environmental adaptability . This genomic plasticity may extend to the mscL gene, with potential implications for channel function in different ecological niches.

The application of average nucleotide identity (ANI) analysis, which has divided 18 strains of B. brevis into distinct groups , could be extended to specifically analyze mscL sequence conservation and divergence patterns, providing insights into functional variations across strains.

What are the most common challenges in achieving functional expression of recombinant B. brevis mscL and how can they be addressed?

Researchers frequently encounter several challenges when expressing recombinant B. brevis mscL. Here are systematic approaches to address these issues:

Challenge 1: Low Expression Yield

ProblemPossible CausesSolutions
Poor protein synthesisCodon biasOptimize codons for expression host
Toxic to hostUse tightly regulated inducible systems (e.g., pLOSS*)
Promoter inefficiencyTest alternative promoters (T7, tac, araBAD)
Protein degradationProtease activityAdd protease inhibitors; use protease-deficient strains
Unstable mRNAOptimize 5' UTR; remove rare codons at N-terminus
Inefficient extractionIncomplete lysisOptimize lysis conditions (sonication parameters, detergent concentration)
Strong membrane associationScreen multiple detergents; use harsher extraction conditions

Challenge 2: Misfolding and Aggregation

ProblemPossible CausesSolutions
Inclusion body formationRapid expression rateLower temperature (16-20°C); reduce inducer concentration
Inadequate chaperonesCo-express with chaperone systems
Aggregation during purificationDetergent incompatibilityScreen detergent panel (DDM, LMNG, DMNG, etc.)
Concentration effectsMaintain dilute conditions; add stabilizing agents
Non-native conformationIncorrect disulfide bondsInclude reducing agents during purification
Improper membrane environmentReconstitute with native-like lipid compositions

Challenge 3: Non-functional Protein

ProblemPossible CausesSolutions
No channel activityDenaturation during purificationOptimize buffer conditions; avoid freeze-thaw cycles
Improper oligomerizationAnalyze oligomeric state by native PAGE or SEC-MALS
Altered gating propertiesTag interferenceRemove tags post-purification; test different tag positions
Lipid environment mismatchSystematically test different lipid compositions
Poor membrane integrationHydrophobic mismatchAdjust lipid bilayer thickness; screen lipid compositions
Incorrect orientationDevelop asymmetric reconstitution protocols

Quality Control Metrics:

  • Expression Assessment:

    • Western blot against His-tag or mscL-specific antibodies

    • Quantification against BSA standards on SDS-PAGE

    • RT-qPCR for mRNA expression levels

  • Purity Evaluation:

    • SDS-PAGE with densitometry (>90% purity target)

    • Size exclusion chromatography profiles

    • Mass spectrometry for contaminant identification

  • Functionality Tests:

    • Patch-clamp electrophysiology with pressure application

    • Fluorescent dye release assays from proteoliposomes

    • In vivo complementation of mscL-deficient E. coli strains

Implementing these strategies systematically can significantly improve success rates in functional expression of recombinant B. brevis mscL protein.

How can researchers validate that purified recombinant B. brevis mscL retains native-like structure and function?

Validating the native-like structure and function of purified recombinant B. brevis mscL requires a multi-faceted approach:

Structural Validation Methods:

Functional Validation Approaches:

  • Electrophysiological Characterization:

    • Patch-Clamp Analysis of Proteoliposomes:

      • Single-channel conductance measurement (expected: 2-3 nS)

      • Pressure-response curve (threshold, slope, saturation)

      • Sub-conductance state analysis

    • Planar Lipid Bilayer Recordings:

      • Channel insertion efficiency

      • Voltage dependence characterization

      • Ion selectivity measurements

  • Flux Assays:

    • Fluorescent Dye Release:

      • Calcein efflux from liposomes under osmotic shock

      • Quantification of release kinetics

    • Ion Flux Measurements:

      • Radioactive ion uptake assays (⁸⁶Rb⁺, ⁴⁵Ca²⁺)

      • Fluorescent ion indicators (SBFI for Na⁺, PBFI for K⁺)

  • Conformational Change Monitoring:

    • Site-Directed Spin Labeling EPR:

      • Mobility parameters at key residues

      • Distances between labeled sites using DEER

    • FRET Measurements:

      • Engineered cysteine pairs labeled with donor-acceptor pairs

      • Tension-dependent FRET efficiency changes

Comparison with Reference Standards:

ParameterExpected Value for Native-like ProteinMethod of Determination
α-Helical content65-75%CD spectroscopy
ThermostabilityTm > 55°CDifferential scanning calorimetry
Oligomeric statePentamer (~ 80 kDa)Native PAGE, SEC-MALS
Pressure threshold8-12 mN/mPatch-clamp with pressure application
Conductance2.5-3.5 nSSingle-channel recordings
Calcein release rate>75% within 30s at 300 mOsm shockFluorescence spectroscopy

These validation approaches provide complementary information about the structural integrity and functional competence of purified recombinant B. brevis mscL protein.

What are the critical factors in experimental design that affect reproducibility in B. brevis mscL research?

Reproducibility in B. brevis mscL research depends on careful attention to multiple experimental variables:

Critical Factors Affecting Reproducibility:

  • Protein Preparation Variables:

    • Expression Conditions:

      • Standardization of induction parameters (OD₆₀₀ at induction, inducer concentration)

      • Precise temperature control during expression (±0.5°C)

      • Consistent harvest timing (stationary vs. log phase)

    • Purification Parameters:

      • Detergent lot-to-lot variation effects on extraction efficiency

      • Consistent buffer composition (pH ±0.1 units, salt concentration ±5%)

      • Handling temperature during processing (membrane proteins sensitive to temperature fluctuations)

    • Storage Conditions:

      • Consistent protein concentration (0.1-1.0 mg/mL recommended)

      • Standardized glycerol concentration (5-50%)

      • Avoiding multiple freeze-thaw cycles

  • Reconstitution Variables:

    • Lipid Composition:

      • Precise lipid ratios (±5% variation can affect function)

      • Lipid purity (oxidized lipids alter membrane properties)

      • Consistent headgroup composition (PC:PE:PG ratios)

    • Protocol Parameters:

      • Protein:lipid ratio (optimal range: 1:200-1:1000)

      • Detergent removal rate (affects proteoliposome size distribution)

      • Buffer ionic strength during reconstitution

  • Functional Assay Variables:

    • Electrophysiology:

      • Patch pipette geometry and resistance

      • Solution composition (ion concentrations, pH)

      • Temperature during recording (±1°C)

    • Fluorescence Assays:

      • Dye loading efficiency

      • Instrument settings (excitation/emission wavelengths, gain)

      • Liposome size distribution

Standardization Recommendations:

VariableStandardization ApproachImpact on Reproducibility
Protein batchesQC metrics: purity >90%, specific activity, oligomeric stateEliminates batch-to-batch variability
Lipid preparationsUse synthetic lipids over natural extracts; verify by TLCReduces compositional uncertainty
Buffer systemsPrepare from common stock solutions; verify pH before useMinimizes preparation errors
Reconstitution protocolDetailed SOP with timing for each step; validate by EMEnsures consistent proteoliposomes
Data analysisStandardized analysis scripts; blinded analysis where possibleReduces analytical bias

Documentation Requirements for Reproducibility:

  • Detailed Methods Reporting:

    • Complete amino acid sequence including any tags

    • Expression system details (strain, plasmid, growth conditions)

    • Purification procedure with all buffer compositions

    • Reconstitution protocol with exact lipid compositions

  • Quality Control Metrics:

    • Purity assessment method and results

    • Functional validation data

    • Storage conditions and stability data

    • Batch number tracking system

  • Raw Data Preservation:

    • Electrophysiological recordings (not just processed traces)

    • Images of gels/blots with molecular weight markers

    • Calibration data for functional assays

By systematically controlling these variables and implementing rigorous documentation practices, researchers can significantly improve reproducibility in B. brevis mscL studies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.