Recombinant Brevibacillus brevis Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Description

Function of LspA

LspA, a type of aspartyl protease, is crucial in processing lipoproteins, which are essential components of the bacterial cell envelope . LspA's mechanism involves obstructing the catalytic dyad, an action that compromises the integrity of the bacterial cell envelope .

LspA in Brevibacillus brevis

Brevibacillus brevis strains produce various nonribosomal peptides and other compounds . These strains can be rapidly typed by generating a mass spectrum of their metabolite products, assisting genomic classification .

LspA and Antibiotics

Antibiotics like globomycin and myxovirescin target LspA, and the structures of LspA in complex with these antibiotics provide insights for drug development . Globomycin and myxovirescin bind to LspA but approach the binding site from different sides .

Importance for Bacterial Survival

LspA activity is important for the survival of bacteria in environments such as human blood . Mutants lacking lspA exhibit reduced survival rates, which can be restored by complementation with the lspA gene .

Brevibacillus brevis as a Biocontrol Agent

Brevibacillus brevis strains, such as HNCS-1, exhibit antagonistic effects against pathogens, demonstrating their potential as biocontrol agents . The antibacterial activity of B. brevis is linked to non-ribosomal peptide synthetase (NRPS) gene clusters, particularly those responsible for producing edeines .

Bioactive Compounds Produced by Brevibacillus Spp.

Brevibacillus species produce a variety of bioactive compounds, including brevipentins, tyrocidines, and gramicidins . Brevipentins, a novel class of pentapeptides, are produced by B. schisleri, B. brevis, and B. porteri .

Table 1: Bioactive products of Brevibacillus strains

Compound FamilyB. schisleriB. brevisB. parabrevisB. formosusB. porteriNovel Genomospecies
Brevipentins++--++
Tyrocidines++++++
C15-Gramicidins--++--
C17-Gramicidins-----+

(+) indicates production, (-) indicates no production

Taxonomic Applications

The metabolite profiles of Brevibacillus species can be used for taxonomic classification, allowing for rapid and accurate typing of strains . Mass spectra of produced metabolites, combined with genome mining data, can efficiently assist genomic classification .

Lipopeptides from Brevibacillus

Brevibacillus species, such as B. laterosporus, produce antimicrobial lipopeptides like brevibacillin, which exhibit activity against Gram-positive and Gram-negative pathogens . These lipopeptides are non-ribosomally synthesized and contain non-proteinogenic amino acid residues and an N-terminal lipid chain .

Potential Applications

Brevibacillus brevis and its products, including LspA, have potential applications in:

  1. Drug Development: Targeting LspA with antibiotics can compromise bacterial cell integrity .

  2. Biocontrol: B. brevis strains can act as biocontrol agents against tea plant pathogens .

  3. Taxonomy: Metabolite profiles can aid in the classification of Brevibacillus species .

  4. Production of Protein A-like Proteins: Brevibacillus can be used to produce protein A-like proteins with immunoglobulin-binding ability .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lspA; BBR47_37810; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Target Names
lspA
Target Protein Sequence
MWYYLIAAVIIALDQFTKYLIVKYMELGESIPLIADVFHLTSHRNMGAAFGILQNRRWFF IAITAVVVIGIVISLIRLGKKQPRASLALSFVLGGAVGNFIDRAMSGQVVDFLDFTLIHF PIFNVADMAITIGVGILLLDVFLDGKKNR
Uniprot No.

Target Background

Function

This protein is a specific catalyst for the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does the structure of B. brevis LspA compare to LspA from other bacterial species?

B. brevis LspA shares structural similarities with LspA from other bacterial species while maintaining unique characteristics. Structural studies of LspA from Staphylococcus aureus (LspMrs) and Pseudomonas aeruginosa (LspPae) reveal important insights applicable to B. brevis LspA:

  • Core structure: LspA typically consists of four transmembrane helices (H1-H4) with catalytic dyad aspartates (positions equivalent to Asp118 and Asp136 in S. aureus) positioned toward the membrane's outer surface .

  • β-cradle: A hemi-cylindrically shaped sheet extends from the catalytic dyad, sitting on the membrane and likely accommodating the stretch of residues to the C-side of the LspA cleavage site in lipoprotein substrates .

  • Extracellular loop (EL): Located between strand 2 (S2) in the β-cradle and H2, this loop sits above the substrate binding pocket and shows flexibility important for substrate binding .

What expression systems are most effective for producing recombinant B. brevis LspA?

Escherichia coli is the most commonly used expression system for producing recombinant B. brevis LspA. Based on the available research, the following expression strategy has proven effective:

  • Host strain: E. coli C43 (DE3) cells, which are particularly suitable for membrane protein expression .

  • Expression vector: pET28a with NdeI and XhoI restriction sites .

  • Gene optimization: Codon optimization for E. coli expression using systems like OptimumGene™ .

  • Construct design: N-terminal hexahistidine-tag followed by a TEV protease cleavage site for tag removal if needed .

  • Expression conditions: Growth in TB media supplemented with 50 μg/mL kanamycin at 37°C to OD600 of 0.5-0.6, followed by induction with 1 mM IPTG at 30°C and 180 rpm for 18 hours .

This system has been demonstrated to produce functional recombinant LspA suitable for both enzyme activity assays and structural studies .

How do natural antibiotics like globomycin and myxovirescin interact with LspA at the molecular level?

The interaction between LspA and natural antibiotics like globomycin and myxovirescin presents a fascinating case of convergent evolution in inhibitory mechanisms. Despite their different molecular structures, both antibiotics inhibit LspA through similar mechanisms:

  • Tetrahedral intermediate analogs: Both antibiotics act as non-cleavable tetrahedral intermediate analogs, mimicking the transition state of the substrate during catalysis .

  • Catalytic dyad blockage: Both position a hydroxyl group between the catalytic aspartates. Globomycin uses the β-hydroxyl of its g.Ser residue, while myxovirescin employs an 8-hydroxyl group .

  • Shared binding motif: Despite structural differences, the two antibiotics superpose along 19 contiguous atoms that interact similarly with LspA. This 19-atom motif recapitulates part of the substrate lipoprotein in its proposed binding mode .

  • Different approach paths: Globomycin approaches from one side of the substrate-binding pocket, while myxovirescin approaches from the other .

Structural analysis of LspA-antibiotic complexes revealed that conserved residues in LspA, particularly Asn52, interact with both antibiotics at the point where they diverge at the extra-membrane entrance to the active site. Asn52's Nδ2 forms a hydrogen bond with the 8-OH in myxovirescin and with the γ-OH on g.Thr in globomycin .

What role does the extracellular loop (EL) play in LspA function and inhibitor binding?

The extracellular loop (EL) of LspA plays a crucial role in both enzyme function and inhibitor binding:

  • Structural flexibility: The EL (a sequence of 11 residues from Asn53 to Lys63 in S. aureus LspA) demonstrates remarkable conformational plasticity .

  • Inhibitor binding: In the globomycin complex, the loop includes a half-turn helix from which extends conserved Trp57, which reaches over the globomycin molecule and secures it against one side of the substrate-binding surface. In contrast, with myxovirescin, the loop unfolds fully and extends deeper into the substrate-binding pocket, enabling Trp57 to contact the macrocycle from the opposite side .

  • Biological significance: This flexibility likely evolved to accommodate the numerous substrate lipoproteins that LspA must process (175 in P. aeruginosa, 67 in S. aureus) .

  • Gly54 importance: This residue is critical for loop flexibility. Mutation of Gly54 to proline, which restricts backbone conformational freedom, completely inactivates the enzyme with lipoprotein substrates .

This adaptability in the EL explains how LspA can process diverse lipoprotein substrates and how different antibiotics have exploited this feature through convergent evolution to effectively inhibit the enzyme .

What enzymatic assays are available for measuring recombinant B. brevis LspA activity?

Several assays have been developed to measure LspA activity, with the following being the most relevant for recombinant B. brevis LspA research:

1. Gel-shift assay with recombinant prolipoprotein:

  • Principle: Detects the size difference between substrate and product on SDS-PAGE

  • Protocol highlights:

    • Reaction mixture: 12 µM pre-proICP (substrate), 250 µM DOPG, 1.2 µM Lgt in buffer (50 mM Tris/HCl pH 7.5, 150 mM NaCl, 1 mM DTT, 0.02% LMNG)

    • Incubation: 37°C, 200 rpm, 60 min for Lgt reaction, followed by addition of 0.5 µM LspA

    • Analysis: Time-course sampling with SDS-PAGE analysis

2. Fluorescence Resonance Energy Transfer (FRET) assay:

  • Principle: Uses single-molecule FRET lipopeptide substrates

  • Advantage: More sensitive and quantitative than gel-shift assays

  • Kinetic parameters: For S. aureus LspA at 0.3 μM concentration, apparent Km of 47 μM and Vmax of 2.5 nmol/(mg min)

3. Inhibition assays:

  • For determining IC50 values of inhibitors like globomycin

  • Observed tight binding inhibition where IC50 values approach the enzyme concentration used

The choice of assay depends on the specific research question, with the FRET assay being preferred for detailed kinetic studies and the gel-shift assay being useful for qualitative assessments of activity.

What are the optimal purification methods for recombinant B. brevis LspA?

Purification of recombinant B. brevis LspA requires specific protocols suited to membrane proteins. Based on successful approaches with homologous LspA proteins, the following procedure is recommended:

Cell preparation:

  • Harvest cells by centrifugation at 6000 × g for 15 min at 4°C

  • Either use immediately or store at -70°C for up to 2 months

Extraction and purification:

  • Cell lysis: Mechanical disruption (e.g., French press) in appropriate buffer containing protease inhibitors

  • Membrane fraction isolation:

    • Centrifugation to remove cell debris

    • Ultracentrifugation to collect membrane fraction

  • Detergent solubilization:

    • Use of an appropriate detergent (e.g., LMNG) at optimized concentration

  • Affinity chromatography:

    • Nickel affinity chromatography using the N-terminal His-tag

    • Washing with increasing imidazole concentrations

    • Elution with high imidazole buffer

  • Optional tag removal:

    • Incubation with TEV protease

    • Reverse affinity chromatography

  • Polishing:

    • Size exclusion chromatography for final purification

Purified LspA should be maintained in buffer containing detergent to prevent aggregation of this membrane protein. Quality assessment by SDS-PAGE and activity assays should be performed to confirm proper folding and function.

How can researchers effectively design site-directed mutagenesis experiments to study B. brevis LspA function?

Site-directed mutagenesis is a powerful approach for investigating structure-function relationships in B. brevis LspA. Based on available structural and functional studies, the following strategy is recommended:

Key residues for mutation studies:

  • Catalytic dyad aspartates (equivalent to Asp118 and Asp136 in S. aureus LspA)

  • Conserved Asn52, which interacts with both globomycin and myxovirescin

  • Gly54, critical for extracellular loop flexibility

  • Trp57, involved in inhibitor binding

  • Other highly conserved residues identified through sequence alignment

Experimental design considerations:

  • Mutation types:

    • Alanine scanning to remove side chain functionality

    • Conservative mutations to preserve charge/size but alter specific properties

    • Non-conservative mutations to dramatically change properties

Activity assessment:
Below is a table showing activity data from similar experiments on S. aureus LspA mutants, which can guide B. brevis LspA studies:

MutantRelative Activity with proICP (%)IC50 Globomycin (μM)
Wild type100171
G54P0ND
N52A<5ND

ND: Not determined due to lack of activity

These approaches allow for systematic investigation of residues important for catalysis, substrate binding, and inhibitor interactions, providing insights into the mechanism of B. brevis LspA function.

What crystallization techniques have proven successful for obtaining LspA structures, and how might they apply to B. brevis LspA?

Crystallization of membrane proteins like LspA presents significant challenges. Based on successful approaches with LspA from other bacterial species, the following techniques are recommended for B. brevis LspA:

1. In Meso Method (Lipidic Cubic Phase):

  • Successfully applied for LspA from P. aeruginosa

  • Process:

    • Reconstitution of purified protein in monoolein

    • Mixing with precipitant solutions

    • Incubation at 20°C for crystal growth

  • Advantages: Stabilizes membrane proteins in a native-like environment

2. Tag Removal Consideration:

  • Removal of the hexahistidine tag can be critical for successful crystallization

  • Example: LspMrs-globomycin complex crystals were only obtained after tag removal

3. Co-crystallization with Inhibitors:

  • Addition of inhibitors like globomycin or myxovirescin can stabilize the protein

  • Molar ratios of 1:3 to 1:5 (protein:inhibitor) have been successful

4. Data Collection and Structure Determination:

  • High-resolution diffraction data collected at synchrotron radiation sources

  • Structures solved by molecular replacement using existing LspA structures as search models

  • Refinement using programs like PHENIX with manual rebuilding in Coot

The highest resolution achieved for LspA structures to date is 1.92 Å for the S. aureus LspA-globomycin complex, providing a benchmark for B. brevis LspA structural studies .

How might B. brevis LspA be utilized in antimicrobial drug discovery efforts?

B. brevis LspA represents a promising target for antimicrobial drug discovery due to several advantageous characteristics:

Target validation rationale:

  • Essential in Gram-negative bacteria

  • No mammalian equivalents (reduced toxicity potential)

  • Accessible active site at the outer surface of the inner membrane

  • Natural antibiotics (globomycin and myxovirescin) already target this enzyme

Structure-based drug design approach:

  • Exploit the common 19-atom motif identified in both globomycin and myxovirescin

  • Incorporate this motif into scaffolds with improved pharmacokinetic properties

  • Design compounds that position a hydroxyl group between the catalytic aspartates

  • Target the flexible extracellular loop to improve specificity

Resistance considerations:

  • LspA contributes to full virulence in Gram-positive bacteria

  • Targeting virulence factors reduces resistance development pressure

  • Incorporating the conserved motif may provide built-in resistance hardiness

Experimental validation path:

  • In vitro enzyme inhibition assays

  • Bacterial growth inhibition testing

  • Human blood survival assays (which showed reduced survival of S. aureus lspA mutants)

  • Animal infection models

This approach leverages the deep structural understanding of LspA-inhibitor interactions to develop novel antimicrobials that could address the global threat of antimicrobial resistance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.