Recombinant Brevibacillus brevis NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, kindly indicate them during order placement. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for necessary arrangements and associated fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
nuoK; BBR47_54380; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-103
Protein Length
full length protein
Species
Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599)
Target Names
nuoK
Target Protein Sequence
MTVSISSYLMVALILFCVGLYGALTKRNAVVVLLSIELMLNAVNINLVAFSKFGLYPSVT GQIFTLFTMTVAAAEVAVGLAILIALYRNKETVNVDEMNQMKR
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. In this species, the immediate electron acceptor for the enzyme is believed to be a menaquinone. This process couples the redox reaction with proton translocation, whereby for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane. This effectively conserves the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of NADH-quinone oxidoreductase subunit K in bacterial metabolism?

NADH-quinone oxidoreductase subunit K functions as an integral membrane component of the respiratory complex I, playing a critical role in electron transport and energy conservation. In bacterial systems, this protein facilitates electron transfer from NADH to quinone while simultaneously contributing to proton or sodium ion translocation across the membrane. This process is fundamental to cellular bioenergetics, as it helps establish the electrochemical gradient necessary for ATP synthesis.

To study this role experimentally, researchers should combine membrane fractionation with activity assays that measure electron transfer rates. The methodological approach should include membrane isolation, protein purification, and reconstitution in proteoliposomes to measure both electron transport and ion translocation activities. Similar approaches have been successfully employed with related NADH-quinone oxidoreductases, as demonstrated in studies with the Na(+)-translocating NADH:quinone oxidoreductase from Vibrio cholerae .

What is the amino acid sequence and structural characteristics of Brevibacillus brevis nuoK?

The amino acid sequence of Brevibacillus brevis NADH-quinone oxidoreductase subunit K consists of 103 amino acids: MTVSSISSYLMVALILFC VGLYGALTKRNAVVVLLSIE LmLNAVNINLVAFSKFGLYPSVT GQIFTLFTMTVAAAEVAVGL AILIALYRNKETVNVDEMNQMKR . This sequence suggests a highly hydrophobic protein with multiple transmembrane domains.

To analyze this sequence effectively, researchers should employ multiple bioinformatic approaches:

  • Hydropathy analysis to identify transmembrane segments

  • Secondary structure prediction algorithms

  • Conservation analysis across bacterial species

  • Topology prediction software

Experimentally, structural characterization can be approached through:

  • Cysteine-scanning mutagenesis coupled with accessibility studies

  • Cryo-electron microscopy of the entire complex

  • NMR studies of isolated domains or synthetic peptides corresponding to segments of interest

How should researchers approach expression and initial characterization of recombinant nuoK?

Successful expression of functional Brevibacillus brevis NADH-quinone oxidoreductase subunit K requires careful consideration of the expression system. Due to its hydrophobic nature and membrane integration, expression in E. coli often leads to inclusion bodies or misfolded protein.

A methodological workflow for successful expression should include:

Expression SystemAdvantagesDisadvantagesOptimization Strategies
Homologous expression in BrevibacillusNative folding environmentLower yieldsOptimize promoter strength and induction conditions
E. coli with fusion tagsHigher yields, easier purificationPotential misfoldingUse specialized strains (C41/C43), lower induction temperature (16-20°C)
Cell-free systemAvoids toxicity issuesExpensive, lower scaleSupplement with lipids or detergents

For initial characterization, researchers should:

  • Verify expression through Western blotting using antibodies against the protein or any fusion tags

  • Assess membrane integration through membrane fractionation

  • Conduct preliminary activity assays similar to those used for related proteins like the V. cholerae Na(+)-NQR, which has been successfully expressed and characterized using histidine tags for purification

How does nuoK interact with other subunits in the NADH-quinone oxidoreductase complex?

Understanding the interactions between nuoK and other subunits requires sophisticated protein-protein interaction studies. Researchers should consider:

  • Co-immunoprecipitation studies with tagged versions of nuoK and other suspected interacting subunits

  • Cross-linking studies followed by mass spectrometry to identify interaction sites

  • Bacterial two-hybrid systems adapted for membrane proteins

  • Förster resonance energy transfer (FRET) using fluorescently labeled subunits

Drawing from studies on related systems like the V. cholerae Na(+)-NQR, it is important to preserve the integrity of the multisubunit complex during purification. Detergent selection is critical, as different detergents may affect subunit interactions. For example, dodecyl maltoside (DM) has been shown to preserve quinone content in purified NADH:quinone oxidoreductase complexes, while LDAO resulted in negligible quinone content .

The experimental approach should include:

  • Stepwise reconstitution of the complex from purified components

  • Mutational analysis of predicted interface residues

  • Activity measurements of the reconstituted complexes to correlate structure with function

What are the ion translocation mechanisms associated with Brevibacillus brevis nuoK?

The ion translocation function of nuoK likely involves specific residues that form an ion channel or participate in a conformational change mechanism. To investigate this:

  • Site-directed mutagenesis should target conserved charged or polar residues within transmembrane segments

  • Ion transport assays should be conducted using reconstituted proteoliposomes with:

    • pH-sensitive fluorescent dyes for proton translocation

    • sodium-sensitive fluorophores for sodium translocation

    • membrane potential-sensitive dyes to measure ΔΨ

Similar approaches with the V. cholerae Na(+)-NQR demonstrated that when reconstituted into liposomes, the enzyme generates both a sodium gradient and a membrane potential (ΔΨ) . For Brevibacillus brevis nuoK, researchers should determine whether the protein participates in proton or sodium ion translocation by systematically varying the ionic composition of the assay buffer.

A comprehensive experimental design would involve:

  • Preparation of proteoliposomes with purified nuoK or the entire complex

  • Measurement of ion gradients using specific ion probes

  • Correlation of electron transfer rates with ion translocation rates

  • Application of inhibitors to distinguish between different mechanisms

How do post-translational modifications affect nuoK function?

Post-translational modifications can significantly alter protein function. For nuoK, researchers should investigate:

  • Phosphorylation sites using phosphoproteomic approaches

  • Potential lipid modifications that might anchor the protein to the membrane

  • Redox modifications of cysteine residues

The experimental approach should involve:

  • Mass spectrometry analysis of purified native and recombinant protein

  • Site-directed mutagenesis of identified modification sites

  • Functional assays comparing wild-type and mutant proteins

  • In vitro modification systems to study the effect of specific modifications

Drawing parallels from other NADH-quinone oxidoreductases, researchers should pay particular attention to flavin modifications. For instance, in V. cholerae Na(+)-NQR, two subunits (NqrB and NqrC) contain covalently bound flavin . While this specific modification may not be present in nuoK, the experimental approach used to identify these modifications can be adapted.

What expression and purification strategies yield the highest activity for recombinant Brevibacillus brevis nuoK?

Optimizing expression and purification of membrane proteins like nuoK requires systematic evaluation of multiple parameters:

ParameterOptionsAssessment Method
Expression hostE. coli, Brevibacillus, cell-freeYield and activity measurements
Fusion tagsHis-tag, MBP, GST, SUMOPurification efficiency and activity retention
DetergentsDDM, LMNG, DM, LDAOProtein stability and activity retention
Purification methodIMAC, ion exchange, size exclusionPurity and specific activity

The most effective methodological approach would be:

  • Generate constructs with C-terminal and N-terminal tags (considering topology predictions)

  • Test expression in multiple systems with varying induction parameters

  • Screen detergents systematically for solubilization efficiency and activity retention

  • Implement multi-step purification strategy, monitoring activity at each step

Studies on Na(+)-NQR from V. cholerae demonstrated successful results using a six-histidine tag on the carboxy terminus of the final subunit in the operon, allowing purification by affinity chromatography while maintaining high activity . A similar approach could be adapted for nuoK, potentially as part of a reconstructed operon if expression of the isolated subunit proves challenging.

How can researchers reliably measure the enzymatic activity of recombinant nuoK?

Establishing robust activity assays is essential for functional characterization of nuoK. Researchers should consider:

  • Spectrophotometric assays monitoring:

    • NADH oxidation at 340 nm

    • Quinone reduction using appropriate quinone analogs

    • Coupled assays with artificial electron acceptors

  • Electrochemical approaches:

    • Electrode-based measurements of electron transfer

    • Membrane potential measurements using sensitive dyes

  • Reconstitution systems:

    • Proteoliposome-based assays for coupled electron transport and ion translocation

    • Co-reconstitution with other components of the respiratory chain

For reliable results, the following methodological considerations are critical:

  • Careful buffer optimization (pH, ionic strength, specific ions)

  • Temperature control during measurements

  • Determination of kinetic parameters (Km, Vmax) under various conditions

  • Validation with known inhibitors

When assessing activity, researchers should be aware that the detergent choice during purification significantly impacts activity. For example, in V. cholerae Na(+)-NQR, purification with dodecyl maltoside (DM) retained bound ubiquinone and resulted in higher activity compared to purification with LDAO .

What approaches are most effective for studying the membrane topology of Brevibacillus brevis nuoK?

Understanding the membrane topology of nuoK is crucial for structure-function studies. Researchers should employ multiple complementary approaches:

  • Computational prediction:

    • Hydropathy analysis

    • Hidden Markov models for transmembrane segment prediction

    • Evolutionary analysis of conserved residues

  • Biochemical approaches:

    • Cysteine scanning mutagenesis with thiol-reactive probes

    • Protease accessibility assays

    • Epitope insertion and antibody accessibility studies

  • Structural approaches:

    • Cryo-electron microscopy of the intact complex

    • Solid-state NMR of reconstituted protein

    • X-ray crystallography of stabilized constructs

A systematic experimental workflow would involve:

  • Initial computational predictions to guide experimental design

  • Introduction of reporter moieties at predicted loops and termini

  • Accessibility studies in membrane vesicles of defined orientation

  • Correlation of topology data with functional studies of mutants

How can researchers distinguish between direct and indirect effects in nuoK mutagenesis studies?

Interpreting mutagenesis data for membrane proteins like nuoK presents unique challenges. To distinguish between direct functional effects and indirect structural perturbations:

  • Perform comprehensive characterization of each mutant:

    • Expression level and membrane integration assessment

    • Structural integrity through limited proteolysis or thermal stability assays

    • Interaction with partner proteins through co-immunoprecipitation

  • Use rescue experiments:

    • Second-site suppressor mutations

    • Chemical rescue for specific residue functions

    • Heterologous complementation

  • Implement correlation analyses:

    • Plot activity versus stability measurements for multiple mutants

    • Identify outliers that maintain stability but lose function

    • Use statistical approaches to classify mutations

The methodological approach should include:

  • Creation of a comprehensive mutant library targeting conserved and non-conserved residues

  • Standardized characterization pipeline for all mutants

  • Multivariate data analysis to identify patterns

  • Structural mapping of results when structural data becomes available

What strategies help resolve conflicting data in electron transport chain studies involving nuoK?

Conflicting data frequently arise in complex multi-protein systems like the electron transport chain. To resolve such conflicts:

  • Systematically identify variables affecting results:

    • Detergent type and concentration (as demonstrated with DM versus LDAO in V. cholerae Na(+)-NQR )

    • Lipid composition in reconstitution experiments

    • Buffer composition, especially ion concentrations

    • Preparation methods and storage conditions

  • Implement methodological triangulation:

    • Use multiple independent assays to measure the same parameter

    • Compare results from different purification approaches

    • Validate in different expression systems

  • Develop quantitative models:

    • Create mathematical models incorporating all measured parameters

    • Use sensitivity analysis to identify critical variables

    • Simulate experimental conditions to predict outcomes

A practical workflow for resolving conflicts would include:

  • Systematic variation of experimental conditions

  • Statistical analysis of replicate experiments

  • Independent verification in different laboratories

  • Correlation with results from related systems

How can structural data be integrated with functional analyses to develop comprehensive models of nuoK function?

Integrating structural and functional data requires sophisticated approaches:

  • Structural mapping of functional data:

    • Map activity-altering mutations onto structural models

    • Identify clusters of functionally important residues

    • Trace potential electron or ion pathways

  • Molecular dynamics simulations:

    • Simulate protein behavior in membrane environments

    • Model conformational changes during the catalytic cycle

    • Predict effects of mutations on dynamics

  • Network analysis approaches:

    • Identify networks of coupled residues through statistical coupling analysis

    • Construct evolutionary covariance matrices

    • Develop allosteric communication models

The methodological framework should include:

  • Generation of structural models through homology modeling or experimental approaches

  • Functional characterization focused on regions of interest identified in structural studies

  • Iterative refinement of models based on new experimental data

  • Development of testable hypotheses from integrated models

What emerging technologies will advance understanding of Brevibacillus brevis nuoK?

Several cutting-edge technologies hold promise for nuoK research:

  • Single-molecule approaches:

    • Single-molecule FRET to track conformational changes

    • Nanodiscs for studying the protein in a native-like environment

    • Single-particle cryo-EM for structural determination

  • Advanced spectroscopic methods:

    • Time-resolved electron paramagnetic resonance

    • Solid-state NMR for membrane protein structure

    • Advanced mass spectrometry for dynamics and interactions

  • Computational approaches:

    • Machine learning for structure prediction

    • Quantum mechanical/molecular mechanical simulations of electron transfer

    • Systems biology models integrating nuoK function with cellular metabolism

Researchers should consider:

  • Establishing collaborations with technology experts

  • Adapting protocols from related systems like the V. cholerae Na(+)-NQR

  • Combining multiple approaches for comprehensive understanding

How can systems biology approaches enhance understanding of nuoK in cellular context?

Understanding nuoK in its cellular context requires systems-level approaches:

  • Multi-omics integration:

    • Transcriptomics to identify co-regulated genes

    • Proteomics to map protein-protein interactions

    • Metabolomics to track metabolic consequences of nuoK manipulation

  • Flux analysis approaches:

    • 13C-metabolic flux analysis to quantify electron flow

    • Oxygen consumption measurements in whole cells

    • Growth phenotyping under various energy sources

  • Synthetic biology approaches:

    • Minimal respiratory chain reconstitution

    • Controlled expression systems for titrating nuoK levels

    • Chimeric proteins to test domain functions

Methodological considerations include:

  • Development of Brevibacillus brevis genetic tools

  • Creation of reporter strains for high-throughput analyses

  • Integration of data across multiple scales from molecular to cellular

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.