Recombinant Bromus secalinus Oleosin 16 kDa (OLE16)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
OLE16; Oleosin 16 kDa
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-167
Protein Length
Full Length of Mature Protein
Species
Bromus secalinus (Rye brome)
Target Names
OLE16
Target Protein Sequence
ADHHRDRGVLGGGALGERGSHGGYGYTGDHGGYGGDDEQHQQKQPVMMCALKAATAATAG GSMLVLSGLILAGTVIALTVATPVLVIFSPVLVPAAISMALMSAGFVTSGGLGVAAVSVF SWMYKYLAGKHPPGADQLDHAKARLASKARDIKDAAQIRVEQAQGA
Uniprot No.

Target Background

Function
This protein may play a structural role in stabilizing lipid bodies during seed desiccation, preventing oil coalescence. It likely interacts with both lipid and phospholipid components of lipid bodies. It may also provide recognition signals for specific lipase binding during lipolysis in seedling growth.
Protein Families
Oleosin family
Subcellular Location
Lipid droplet. Membrane; Multi-pass membrane protein.

Q&A

What is the biological function of OLE16 in seeds?

OLE16 plays several critical roles in seed development and germination:

  • It stabilizes lipid bodies (oil bodies) during seed desiccation by preventing coalescence of oil droplets .

  • It maintains oil bodies as small single units, which is crucial for proper seed development and subsequent germination .

  • It interacts with both lipid and phospholipid moieties of lipid bodies .

  • It provides recognition signals for specific lipase anchorage during lipolysis in seedling growth .

  • It contributes to the proper spatial organization of storage organelles within seed cells .

Research using oleosin-suppressed Arabidopsis demonstrates that when oleosins are absent or reduced, seeds develop abnormally large oil bodies that disrupt cellular architecture, alter lipid and protein accumulation, and delay germination . These aberrant phenotypes can be partially reversed by introducing recombinant oleosins from other species, including OLE16 from maize .

What are the most effective methods for isolating OLE16 from plant tissues?

Isolation of native OLE16 from Bromus secalinus seeds requires a multi-step approach:

  • Seed homogenization: Grind seeds in buffer at pH 6.0-6.5 (optimal for oleosin extraction) .

  • Oil body isolation: Centrifuge the homogenate at low speed (10,000g) to remove debris, then at high speed (100,000g) to float oil bodies.

  • Purification: Carefully collect the floating oil body layer and wash multiple times with buffer to remove contaminating proteins.

  • Protein extraction: Extract oleosins from oil bodies using detergent (typically 0.1% SDS or Triton X-100).

  • Protein separation: Use SDS-PAGE to separate proteins, with OLE16 appearing as a band at approximately 16-17 kDa.

  • Verification: Confirm identity via Western blotting with oleosin-specific antibodies or through mass spectrometry .

For enhanced purity, researchers should be aware that oil body extracts typically contain both intrinsic proteins (oleosins) and extrinsic proteins that can interfere with analysis. Multiple washing steps using high salt buffers can help remove these contaminants.

How should I design primers for cloning full-length OLE16 cDNA?

For successful amplification of full-length OLE16 cDNA, follow these methodological steps:

  • Sequence information gathering: For Bromus secalinus OLE16, start with available sequence data (Accession: U72411.1) . If direct sequence is unavailable, use closely related sequences from rice (Accession: X82678.1), maize (Accession: U13701.1) or barley as references .

  • Primer design strategy:

    • For known sequences, design end-to-end primers targeting 5' and 3' UTRs

    • For unknown regions, implement RACE-PCR using gene-specific primers

    • Include appropriate restriction sites for subsequent cloning

    • Consider GC content (45-55%) and melting temperatures (~60°C)

  • PCR optimization: Use high-fidelity polymerase, optimize annealing temperature (55-62°C), and consider touchdown PCR for improved specificity .

  • Product verification: Clone the PCR product into a sequencing vector (pCR4-TOPO recommended) and sequence using M13 primers to confirm the complete OLE16 sequence .

This approach has been successfully used to isolate the full-length cDNA of oleosin from various plant sources, including oil palm with high sequence similarity to Bromus secalinus OLE16 .

What expression systems and conditions yield functional recombinant OLE16?

The choice of expression system significantly impacts the functionality of recombinant OLE16. Based on published literature, researchers should consider:

  • Prokaryotic expression (E. coli):

    • Advantages: High yield, simple culture conditions

    • Limitations: Lacks post-translational modifications, protein may form inclusion bodies

    • Optimization: Use BL21(DE3) strain, induce at low temperature (16-20°C), include solubility enhancers (CHAPS, sarcosyl)

    • Tags: N-terminal His6 or MBP tags improve solubility and purification

  • Plant-based expression:

    • Advantages: Native post-translational modifications, proper oil body targeting

    • Recommended systems: Arabidopsis (especially oleosin-deficient lines), tobacco, or soybean

    • Transformation method: Agrobacterium-mediated transformation

    • Expression verification: Western blotting of oil body fraction

  • Yeast expression (S. cerevisiae or P. pastoris):

    • Advantages: Eukaryotic processing, high density cultures

    • Promoters: GAL1 (S. cerevisiae) or AOX1 (P. pastoris)

    • Induction: Galactose or methanol, respectively

For reintroducing recombinant OLE16 into oleosin-suppressed plants, studies have demonstrated successful complementation using maize OLE16, which has 77% similarity to Bromus secalinus OLE16 . This approach validates protein functionality by assessing oil body morphology restoration.

How can I assess the functionality and stability of recombinant OLE16?

A comprehensive assessment of recombinant OLE16 functionality requires multiple complementary approaches:

  • Oil body formation assay:

    • Mix purified recombinant OLE16 with phospholipids and neutral lipids (typically triolein)

    • Evaluate oil body formation using dynamic light scattering and transmission electron microscopy

    • Functional OLE16 should produce uniform oil bodies (0.5-2 μm diameter)

  • Thermal and pH stability:

    • Assess protein stability across temperature range (4-70°C) and pH range (4-11)

    • Functional OLE16 shows stability at pH 6.0-6.5 and temperatures below 60°C

    • Monitor unfolding using circular dichroism spectroscopy

  • Coalescence prevention:

    • Subject artificial oil bodies to stress conditions (heating to 50°C, freezing-thawing cycles)

    • Measure particle size distribution before and after stress

    • Functional OLE16 prevents significant increase in oil body size

  • Structure verification:

    • Circular dichroism to confirm secondary structure elements

    • Fourier transform infrared spectroscopy to analyze protein folding

    • Protease protection assay to verify proper membrane integration

  • In vivo complementation:

    • Transform oleosin-suppressed plants with recombinant OLE16

    • Examine seed oil body morphology (confocal microscopy)

    • Assess germination rates and lipid mobilization during seedling establishment

These assays provide a robust framework for validating recombinant OLE16 functionality beyond simple expression confirmation.

How does OLE16 phosphorylation affect its function, and how can this be experimentally investigated?

Oleosins undergo phosphorylation as a key regulatory post-translational modification. For OLE16, this process affects oil body dynamics and protein stability. To investigate this phenomenon:

  • Identification of phosphorylation sites:

    • Perform in silico analysis using phosphorylation prediction tools (NetPhos, PhosphoSite)

    • Conduct phosphoproteomic analysis of native OLE16 using LC-MS/MS

    • Compare with known phosphorylation sites in related oleosins (e.g., Arabidopsis OLE1 is phosphorylated at Thr166)

  • Mutagenesis approach:

    • Generate site-directed mutants of potential phosphorylation sites:

      • Phosphomimetic mutants (Ser/Thr → Asp/Glu)

      • Phosphodeficient mutants (Ser/Thr → Ala)

    • Express these variants and assess effects on:

      • Oil body morphology and size distribution

      • Protein-lipid interactions

      • Protein stability and degradation kinetics

  • Kinase identification:

    • Conduct in vitro kinase assays with candidate kinases

    • Perform co-immunoprecipitation to identify interacting kinases

    • Use kinase inhibitors to validate in vivo

  • Functional impact assessment:

    • Monitor oil body dynamics during seed development and germination

    • Track protein degradation patterns in phosphovariants

    • Assess impact on lipid mobilization during germination

Studies have shown that phosphorylation may regulate oleosin degradation during germination, potentially recruiting proteases to initiate oil body breakdown . The experimental approaches outlined above would provide crucial insights into this regulatory mechanism for OLE16.

How can recombinant OLE16 be optimized for protein purification applications?

Recombinant OLE16 offers a powerful platform for protein purification through oil body partitioning. Optimizing this system requires:

  • Fusion protein design considerations:

    • Position of fusion partner (N- or C-terminus of OLE16)

    • Inclusion of flexible linker sequences (Gly-Ser repeats recommended)

    • Incorporation of specific protease cleavage sites (TEV, thrombin, or Factor Xa)

    • Retention of critical OLE16 structural elements, particularly the hydrophobic domain

  • Expression optimization strategy:

    • Select appropriate host (plant systems provide natural oil body formation)

    • Use seed-specific promoters for temporal control

    • Optimize codon usage for selected expression system

    • Incorporate purification tags if needed for secondary purification steps

  • Oil body isolation protocol:

    • Optimize buffer composition (pH 6.0-6.5 is optimal)

    • Establish floating/centrifugation parameters

    • Implement washing steps to remove contaminating proteins

    • Validate purity through proteomics analysis

  • Target protein release methods:

    • Enzymatic cleavage optimization (protease concentration, temperature, time)

    • Physical disruption of oil bodies (sonication, detergent treatment)

    • Separation of cleaved protein from oil body fraction

  • Scale-up considerations:

    • Consistent seed production

    • Standardized extraction procedures

    • Reproducible yield and purity metrics

This approach has been successfully commercialized (e.g., by SemBioSys) for manufacturing high-value recombinant proteins with significantly reduced purification costs compared to conventional methods .

What are the experimental approaches to study OLE16's role in seed dormancy and germination?

To investigate OLE16's involvement in dormancy and germination processes, researchers should implement a multi-faceted experimental strategy:

  • Temporal expression analysis:

    • Conduct qRT-PCR and Western blotting to track OLE16 expression across:

      • Seed development stages

      • Primary and secondary dormancy induction

      • Germination progression

    • Correlate expression patterns with physiological changes and dormancy states

  • Genetic manipulation approaches:

    • Generate transgenic lines with:

      • OLE16 overexpression

      • RNAi-mediated suppression

      • CRISPR/Cas9 knockout

    • Assess effects on:

      • Dormancy depth

      • Germination timing and uniformity

      • Seedling establishment success

      • Oil body morphology and dynamics

  • Environmental regulation studies:

    • Examine how different conditions affect OLE16 expression and modification:

      • Temperature regimes (including cold stratification)

      • Water potential

      • Light quality and quantity

    • Link findings to secondary dormancy induction mechanisms

  • Molecular interaction mapping:

    • Identify proteins interacting with OLE16 during dormancy release using:

      • Co-immunoprecipitation

      • Yeast two-hybrid screening

      • Proximity labeling approaches

    • Focus on potential proteases, lipases, and regulatory proteins

  • Oil body dynamics visualization:

    • Implement live-cell imaging with fluorescently labeled OLE16

    • Track oil body size changes during dormancy release and germination

    • Quantify lipid mobilization rates in relation to OLE16 modifications

Research has shown that oleosins undergo regulated degradation during germination, potentially through ubiquitination and protease action, making these critical processes to monitor when studying OLE16's role in this transition .

What methodological approaches can resolve OLE16's three-dimensional structure?

Determining the 3D structure of OLE16 presents significant challenges due to its hydrophobic nature and membrane association. A comprehensive structural biology approach should include:

Despite extensive research on oleosins, high-resolution structures remain elusive, making this a frontier area in the field. Current structural information is limited to secondary structure predictions and low-resolution models .

How does OLE16 from Bromus secalinus compare functionally with oleosins from other species?

Comparative analysis reveals both conservation and divergence among oleosins from different plant species:

  • Sequence and structural comparison:

    SpeciesLength (aa)Mass (kDa)Sequence IdentityKey Structural Differences
    Bromus secalinus16716.996ReferenceLonger N-terminal domain
    Zea mays15615.793~77% Shorter C-terminal domain
    Oryza sativa14815.2~78% Shorter N-terminal domain
    Arabidopsis (OLE1)~180~18LowerExtended C-terminal region
  • Functional conservation:

    • All oleosins maintain the core function of stabilizing oil bodies

    • The hydrophobic domain and proline knot motif are highly conserved

    • Cross-species complementation experiments demonstrate functional equivalence:

      • Maize OLE16 partially restored normal phenotype in OLE1-suppressed Arabidopsis

      • This suggests fundamental mechanisms are preserved across species

  • Species-specific adaptations:

    • Expression patterns vary:

      • Some oleosins are exclusively expressed in seeds

      • Others show expression in vegetative tissues (leaves, roots)

    • Phosphorylation sites differ between species

    • Interaction partners may be species-specific

    • Response to environmental stresses varies

  • Evolutionary implications:

    • The central hydrophobic domain shows highest conservation

    • Terminal domains evolve more rapidly, suggesting adaptation to species-specific requirements

    • Gene duplication has led to multiple oleosin isoforms with specialized functions

Understanding these interspecies differences provides valuable insights for researchers selecting oleosins for specific applications, particularly when considering cross-species expression systems or biotechnological applications.

How can recombinant OLE16 be used to create artificial oil bodies for drug delivery?

Recombinant OLE16 provides a platform for developing biomimetic artificial oil bodies (AOBs) with significant potential in drug delivery applications. The methodological approach involves:

  • Production of functional recombinant OLE16:

    • Express in suitable host (E. coli or yeast systems)

    • Purify using affinity chromatography

    • Validate structural integrity and lipid-binding capacity

  • Artificial oil body assembly protocol:

    • Components ratio optimization:

      • OLE16 (1-5% w/w)

      • Phospholipids (0.5-2% w/w)

      • Triacylglycerols (remainder)

    • Assembly methods:

      • High-pressure homogenization

      • Ultrasonication

      • Membrane extrusion

    • Size control parameters:

      • OLE16:lipid ratio (higher protein content yields smaller AOBs)

      • Processing pressure/time

      • Temperature during formation

  • Drug incorporation strategies:

    • For hydrophobic drugs:

      • Direct incorporation into lipid phase before AOB formation

      • Passive loading into preformed AOBs

    • For hydrophilic drugs:

      • Conjugation to OLE16 terminal domains

      • Use of surface-modifying agents

  • Characterization requirements:

    • Size distribution (dynamic light scattering)

    • Morphology (transmission electron microscopy)

    • Stability assessment (zeta potential, aggregation kinetics)

    • Encapsulation efficiency (HPLC quantification)

    • Drug release profiles (dialysis method)

  • Recombinant OLE16 modifications for enhanced delivery:

    • Site-directed mutagenesis to modify:

      • Surface charge properties

      • Hydrophobic domain length

      • Protease resistance

    • Fusion with targeting peptides or antibody fragments

    • Addition of stimuli-responsive domains

The advantages of OLE16-based AOBs include biocompatibility, high stability due to the unique oleosin structure, and the ability to carry both hydrophobic and hydrophilic therapeutic agents .

What approaches can determine if recombinant OLE16 poses potential allergenicity risks?

Assessing the allergenicity potential of recombinant OLE16 is essential for research and biotechnological applications, particularly given that oleosins from several plants have been identified as allergens . A comprehensive evaluation should include:

  • In silico allergenicity assessment:

    • Compare OLE16 sequence with known allergen databases (AllergenOnline, SDAP)

    • Identify potential IgE-binding epitopes using prediction algorithms

    • Compare with documented allergenic oleosins from peanut, hazelnut, and sesame seed

    • Assess sequence homology and structural similarity to known allergens

  • Biochemical and immunological analysis:

    • ELISA screening:

      • Test reactivity of purified OLE16 with sera from allergic patients

      • Compare with known allergenic and non-allergenic oleosins

    • Immunoblotting:

      • Assess IgE binding under denaturing and native conditions

      • Evaluate cross-reactivity with oleosins from common allergenic foods

    • Basophil activation test:

      • Measure activation markers (CD63, CD203c) after exposure to OLE16

      • Determine threshold concentrations for cellular responses

  • Epitope mapping procedure:

    • Generate overlapping peptides spanning OLE16 sequence

    • Test individual peptides for IgE binding

    • Identify specific allergenic regions, focusing on exposed portions of the protein

    • Determine if epitopes are sequential or conformational

  • Structural considerations:

    • Assess epitope accessibility when OLE16 is:

      • In solution

      • Embedded in oil bodies

      • Fused to other proteins

    • Evaluate whether hydrophobic domains (normally buried in oil bodies) contribute to allergenicity

  • Risk mitigation strategies:

    • Site-directed mutagenesis of identified epitopes

    • Epitope masking through protein engineering

    • Processing modifications to reduce allergenicity potential

Research has shown that oleosins can trigger allergic reactions despite being embedded in oil bodies, making thorough allergenicity assessment crucial for applications involving recombinant OLE16 .

What methodological challenges remain in understanding OLE16's interactions with lipid bodies?

Despite advances in oleosin research, several methodological challenges persist in characterizing OLE16-lipid interactions:

  • Technical limitations in structural analysis:

    • Difficulty in crystallizing membrane-associated proteins

    • Challenges in maintaining native lipid environment during analysis

    • Limited resolution of current imaging techniques for dynamic interactions

    • Constraints in simultaneous tracking of proteins and lipids

  • Methodological solutions and emerging approaches:

    • Advanced imaging techniques:

      • Super-resolution microscopy (PALM/STORM) to visualize individual oleosins

      • Single-molecule tracking to monitor dynamic behavior

      • FRET-based approaches to measure protein-lipid proximity

      • Four-dimensional confocal microscopy to track oil body dynamics over time

    • Artificial systems development:

      • Designer oil bodies with controlled composition

      • Asymmetric phospholipid-amphiphilic protein vesicles

      • Fluorescently labeled OLE16 variants for real-time monitoring

      • Reconstituted oil bodies with defined properties

    • Biophysical characterization methods:

      • Atomic force microscopy to measure interaction forces

      • Neutron reflectometry to analyze membrane insertion

      • Surface plasmon resonance to quantify binding kinetics

      • Small-angle X-ray scattering to determine low-resolution structures

  • Challenges in studying physiological context:

    • Reproducing developmental conditions in vitro

    • Accounting for tissue-specific factors and cytoskeletal interactions

    • Modeling the dynamic nature of oil bodies during seed development and germination

    • Integrating multiple protein components of the oil body proteome

  • Computational modeling limitations:

    • Accurately representing the oil body phospholipid monolayer

    • Simulating large-scale protein aggregation and organization

    • Connecting molecular-level interactions to macroscopic oil body behavior

Addressing these challenges requires interdisciplinary approaches combining advanced imaging, synthetic biology, and computational modeling to fully understand the structural basis of OLE16 function in oil body dynamics .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.