Recombinant Brucella abortus Aquaporin Z (aqpZ)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Brucella abortus

aqpZ is implicated in osmotic adaptation and intracellular survival:

Osmoregulation

  • Hypertonic Stress Response: Analogous to B. abortus aqpX, aqpZ may mediate rapid water fluxes during osmotic shifts, aiding survival in host environments .

  • Growth Phase Regulation: Expression peaks during the mid-exponential phase, aligning with metabolic demands for rapid water transport .

Pathogenicity and Host Interaction

While direct evidence for aqpZ’s role in virulence is limited, aquaporins in related pathogens (e.g., E. coli) contribute to acid shock tolerance and membrane stability .

Recombinant Expression and Production

Recombinant aqpZ is produced via heterologous systems, with key parameters summarized below:

ParameterDetailsSource
Expression HostE. coli (pCold-TF vector or similar)
TagN-terminal His-tag (10xHis) for affinity chromatography
ReconstitutionDeionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability
ApplicationsStructural studies, vaccine development, biomimetic membrane integration

Vaccine Development

While aqpZ itself has not been tested in vaccines, its homologs (e.g., Omp28, L7/L12) are components of subunit vaccines inducing Th1-dominated immunity . Future studies may explore aqpZ’s immunogenicity given its surface localization and conserved domains .

Biomimetic Membrane Technologies

Recombinant aqpZ is integrated into synthetic membranes to enhance water permeability and selectivity. Key findings:

ApplicationOutcomeSource
Water PurificationHigh flux rates in lipid-polymer hybrid membranes
StabilityReduced permeability under acid shock, suggesting pH-sensitive gating

Future Directions

  1. Structural Analysis: Crystallization of B. abortus aqpZ to resolve substrate selectivity.

  2. Vaccine Efficacy: Testing aqpZ in combination with other antigens (e.g., RB51 strain modifications) .

  3. Pathogenic Mechanisms: Investigating aqpZ’s role in intracellular survival and host immune evasion.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
aqpZ; aqpX; BAB1_2001; Aquaporin Z; Aquaporin X
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Brucella abortus (strain 2308)
Target Names
Target Protein Sequence
MLNKLSAEFFGTFWLVFGGCGSAILAAAFPELGIGFLGVALAFGLTVLTMAYAVGGISGGHFNPAVSLGLTVAGRLPAKDLIPYWVAQVLGAIAAAAILYVIASGKDGFSAGGLASNGYGELSPGGYSMMAGLLIEIILTAFFIIIILGSTSSLAPAGFAPIAIGFGLTLIHLVSIPVTNTSVNPARSTGVALFADRAALSQLWLFWVAPLVGAVIGAIIWKGLLGRD
Uniprot No.

Target Background

Function
Facilitates the transport of water across the membrane. It may play a role in adapting to variations in intravacuolar pH or osmolarity.
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the structure of bacterial Aquaporin Z compare to mammalian aquaporins?

Bacterial Aquaporin Z shares significant structural homology with mammalian aquaporins, particularly human Aquaporin 4 (Aqp4). Research has provided direct evidence for structural homology and cross-immunoreactivity between bacterial AqpZ and human Aqp4 proteins . This structural similarity is significant as it suggests evolutionary conservation of water channel proteins across diverse species.

The structural homology between bacterial AqpZ and human Aqp4 has implications beyond basic structural biology. Studies indicate that infection-induced cross-immunoreactivity may play a role in the induction of anti-Aqp4 autoimmune responses in neuromyelitis optica (NMO), a severe neurological autoimmune disorder . This finding highlights the potential relevance of bacterial aquaporins in understanding certain human autoimmune conditions and suggests that molecular mimicry between bacterial and human proteins may contribute to autoimmune pathology.

What are the recommended expression systems for producing recombinant Brucella abortus Aquaporin Z?

Several expression systems have been successfully employed for the production of recombinant Brucella abortus Aquaporin Z, with Escherichia coli being the predominant host. Below are methodological approaches based on published research:

  • His-tagged expression system:

    • Expression vector: pEcoli-C term 6×HN (or similar vectors with His-tag sequences)

    • Host strain: BL21/DE3 E. coli

    • Induction: 3 mM isopropyl β-D thiogalactopyranoside (IPTG)

    • Incubation conditions: Overnight at 37°C

    • Purification method: HisTALON Gravity Columns or similar affinity chromatography

  • MBP fusion system:

    • Expression vector: pMAL-c4X bacterial expression vector (containing maltose-binding protein gene)

    • Host strain: BL21/DE3 E. coli

    • Induction: IPTG (concentration as optimized)

    • Purification: Maltose-dependent affinity elution

    • Additional processing: Cleavage from MBP with Factor Xa protease followed by additional affinity purification

For optimal protein quality, it is recommended to isolate the protein in the absence of reducing agents and store in PBS (pH 7.4) to prevent denaturation. Quality control should include 8–16% gradient SDS-PAGE, endotoxin testing, mass spectroscopy, and Western blot verification .

What are the critical considerations for maintaining stability and functionality of purified recombinant aqpZ?

Maintaining the stability and functionality of purified recombinant Brucella abortus Aquaporin Z requires careful attention to storage conditions and handling procedures:

Storage Recommendations:

  • For liquid formulations: Store at -20°C or -80°C with a typical shelf life of 6 months

  • For lyophilized formulations: Store at -20°C or -80°C with an extended shelf life of 12 months

  • Working aliquots should be stored at 4°C and used within one week

Critical Considerations:

  • Buffer composition: Tris-based buffers with 50% glycerol have been found to be optimal for maintaining protein stability

  • Avoid denaturation: Isolation should be performed in the absence of reducing agents, with storage in PBS (pH 7.4)

  • Minimize freeze-thaw cycles: Repeated freezing and thawing is not recommended as it can compromise protein integrity and functionality

  • Aliquoting strategy: Prepare small working aliquots to avoid repeated freeze-thaw cycles of the entire stock

The stability of the protein is influenced by multiple factors including storage state, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself . For functional studies, it's essential to verify that the protein maintains its native conformation and water channel activity after purification.

How does aqpZ expression change under different environmental stresses in Brucella abortus?

Research on aqpZ expression patterns in Brucella abortus reveals significant regulation in response to environmental stresses, particularly osmotic changes:

Osmotic Stress Response:

  • Hyperosmolar conditions: aqpZ gene expression and mRNA levels are markedly increased under hyperosmolar conditions, suggesting a role in adaptation to high osmolarity environments

  • Hypo-osmolar conditions: While expression is not significantly induced, aqpX null mutants show reduced viability after 50 hours of growth in hypo-osmolar conditions, indicating the protein's importance in long-term adaptation to low osmolarity environments

Growth Phase-Dependent Regulation:

  • Expression levels of aqpZ are enhanced during the mid-exponential phase of bacterial growth, indicating growth-dependent regulation

Nutrient Limitation Response:

These expression patterns suggest that aqpZ plays a critical role in B. abortus adaptation to changing environmental conditions, particularly those encountered during host infection. The specific induction in hyperosmolar conditions represents the first reported example of a bacterial aquaporin induced in hypertonic conditions .

What is the functional impact of aqpZ gene disruption on Brucella abortus viability and stress response?

Studies using aqpX null mutants have provided insights into the functional importance of Aquaporin Z in Brucella abortus:

Growth Under Standard Conditions:

  • aqpX null mutants show no significant difference in growth rate compared to wild-type strains when grown in rich and minimal media, indicating that aqpZ is not essential for bacterial growth under standard laboratory conditions

Response to Osmotic Stress:

  • Hyperosmolar conditions: Knockout mutants do not show affected growth rates in hyperosmolar environments, suggesting compensatory mechanisms may exist

  • Hypo-osmolar conditions: Mutants exhibit reduced viability after 50 hours of growth, indicating that aqpZ plays an important role in long-term adaptation to hypo-osmotic stress

Implications for Pathogenesis:

  • During host infection, B. abortus encounters various stress conditions including oxidative stress, nutrient limitation, and pH changes. Proteomic studies have shown that B. abortus undergoes significant metabolic adaptation in response to these stresses

  • While the direct link between aqpZ and virulence has not been fully established, the protein's role in osmotic adaptation suggests it may contribute to bacterial survival during specific stages of infection

These findings indicate that while aqpZ is not essential for basic bacterial survival, it provides a selective advantage during specific stress conditions, particularly long-term adaptation to hypo-osmolar environments. This suggests a specialized role in the stress response repertoire of B. abortus.

What are the recommended protocols for studying aqpZ gene expression in Brucella abortus?

Several complementary approaches have been validated for studying aqpZ gene expression in Brucella abortus:

1. β-Galactosidase Reporter Assays:

  • Construction of an aqpX::lacZ gene fusion for integration into the B. abortus genome

  • Culture bacteria under various conditions (standard, hyperosmolar, hypo-osmolar)

  • Harvest cells at different growth phases and perform standard β-galactosidase assays

  • This approach allows quantitative measurement of promoter activity under different conditions

2. RT-PCR Analysis:

  • Extract total RNA from B. abortus cultures grown under different conditions

  • Perform reverse transcription to generate cDNA

  • Amplify aqpZ transcripts using specific primers

  • Quantify relative transcript levels normalized to appropriate housekeeping genes

  • This method provides direct measurement of aqpZ mRNA levels

3. Proteomic Analysis:

  • Culture B. abortus under different stress conditions (e.g., pH stress, oxidative stress, nutrient limitation)

  • Prepare whole cell lysates and perform LC-MS/MS analysis

  • Identify and quantify aqpZ protein using label-free quantification methods

  • Compare protein abundance across different conditions

  • This approach enables protein-level expression analysis in the context of the global proteome response

For comprehensive expression analysis, it is recommended to combine these approaches to assess regulation at both transcriptional and translational levels. When designing experiments, it's important to consider growth phase effects, as aqpZ expression has been shown to be enhanced during mid-exponential phase .

How can functional water transport activity of recombinant aqpZ be assessed in vitro?

Assessing the functional water transport activity of recombinant Brucella abortus Aquaporin Z can be accomplished through several established methodologies:

1. Proteoliposome-Based Water Permeability Assays:

  • Reconstitute purified recombinant aqpZ into proteoliposomes

  • Subject proteoliposomes to rapid osmotic gradients using a stopped-flow spectrophotometer

  • Measure the rate of liposome shrinkage/swelling via light scattering

  • Calculate water permeability coefficients (Pf) by fitting the light scattering curves to exponential functions

  • Compare water transport rates between aqpZ-containing proteoliposomes and control liposomes

2. Xenopus Oocyte Expression System:

  • Express recombinant aqpZ in Xenopus oocytes via microinjection of cRNA

  • Place oocytes in hypotonic solution and measure the rate of swelling

  • Calculate water permeability from the initial rate of volume change

  • Compare water permeability between aqpZ-expressing oocytes and control oocytes

3. Yeast-Based Functional Complementation:

  • Express recombinant aqpZ in aquaporin-deficient yeast strains

  • Subject transformants to osmotic stress challenges

  • Measure growth rates and survival under osmotic stress conditions

  • Compare performance of aqpZ-expressing strains with control strains

For all functional assays, it's important to include appropriate controls:

  • Positive controls: Well-characterized aquaporins with known water transport activity

  • Negative controls: Non-functional aquaporin mutants or empty vector controls

  • Inhibition controls: Mercury compounds (e.g., HgCl₂) that inhibit aquaporin function

These methodologies enable quantitative assessment of water transport capacity and can be extended to study the effects of pH, temperature, and potential inhibitors on aqpZ function.

What is the potential role of bacterial aqpZ in cross-immunoreactivity with human aquaporins?

Research has revealed intriguing connections between bacterial Aquaporin Z and human aquaporins, particularly regarding cross-immunoreactivity:

Structural Homology and Cross-Immunoreactivity:

  • Direct evidence exists for structural homology between bacterial AqpZ and human Aquaporin 4 (Aqp4)

  • This structural similarity results in cross-immunoreactivity, where antibodies generated against bacterial AqpZ can recognize human Aqp4 proteins

Implications for Autoimmune Disorders:

  • The cross-immunoreactivity between bacterial AqpZ and human Aqp4 may play a role in the induction of anti-Aqp4 autoimmune responses seen in neuromyelitis optica (NMO), a severe neurological autoimmune disorder

  • This suggests a potential molecular mimicry mechanism, where immune responses initially directed against bacterial proteins cross-react with structurally similar human proteins

Research Methodologies:
To investigate this cross-immunoreactivity, researchers have employed:

  • Production of recombinant proteins (both bacterial AqpZ and human Aqp4)

  • Generation of antibodies against these proteins

  • Cross-reactivity testing using Western blot, ELISA, and immunofluorescence techniques

  • Epitope mapping to identify specific regions involved in cross-reactivity

This research area represents an important intersection between microbiology and immunology, potentially providing insights into how bacterial infections might trigger or exacerbate certain autoimmune conditions through molecular mimicry mechanisms.

How might aqpZ function in the context of the Brucella abortus stress response network?

Brucella abortus encounters numerous stresses during its lifecycle, particularly within host cells. Understanding how aqpZ functions within the broader stress response network provides insights into bacterial adaptation and pathogenesis:

Integration with Global Stress Responses:

  • Proteomic analyses of B. abortus under various stress conditions have revealed coordinated responses involving hundreds of differentially expressed proteins

  • These responses include modulation of oxidative phosphorylation, TCA cycle activity, and various metabolic pathways

Metabolic Adaptation:

  • During stress conditions, B. abortus undergoes significant metabolic remodeling, including down-regulation of energy metabolism via the TCA cycle when faced with nutrient limitation

  • The role of aqpZ may be contextualized within this broader metabolic adaptation, potentially contributing to osmotic balance during metabolic shifts

Stress Response Network Connections:

  • The induction of aqpZ in hyperosmolar conditions suggests specific regulatory pathways controlling its expression

  • These may include osmosensing systems, two-component regulatory systems, or global stress regulators

  • Understanding these connections requires systematic investigation of aqpZ expression in various regulatory mutants

Research Approaches:
Future research to elucidate aqpZ's role in the stress response network might include:

  • Network analysis integrating transcriptomic, proteomic, and metabolomic data

  • Analysis of aqpZ expression in strains with mutations in key stress response regulators

  • Phenotypic characterization of aqpZ mutants under combined stress conditions

  • Investigation of protein-protein interactions between AqpZ and other stress response proteins

Understanding these network connections has implications for both basic bacterial physiology and potential therapeutic interventions targeting bacterial stress adaptation mechanisms.

What factors should be considered when designing experiments to study aqpZ in Brucella abortus infection models?

When designing experiments to study the role of Aquaporin Z during Brucella abortus infection, researchers should consider several critical factors:

In Vitro Stress Models:

  • The survival rates of B. abortus under various in vitro stress conditions range from 3.17% to 73.17%, with multi-stress conditions resulting in the lowest survival rates

  • These stress conditions can be designed to more accurately reflect the in vivo conditions encountered during intracellular infection

Table 1: Survival Rates of B. abortus Under Different Stress Conditions

Stress ConditionApproximate Survival Rate (%)
Control condition100.00
Single stress conditions3.17 - 73.17
Multi-stress conditionsLowest (precise value not specified)

Cellular Infection Models:

  • Macrophage infection models: Primary macrophages or macrophage cell lines (e.g., RAW264.7, J774)

  • Non-phagocytic cell infection models: Epithelial cells (e.g., HeLa)

  • Consider the timing of sampling, as aqpZ expression varies with growth phase

  • Include appropriate controls (wild-type and complemented mutant strains)

Animal Infection Models:

  • Mouse models: BALB/c mice are commonly used for B. abortus infection studies

  • Consider organ-specific colonization (spleen, liver) in assessment of virulence

  • Time course experiments to capture different infection stages

  • Consider both acute and chronic infection phases

Experimental Readouts:

  • Bacterial survival and replication within cells/tissues

  • Host cell responses (cytokine production, cell death)

  • In vivo gene expression analysis (e.g., RT-PCR from infected tissues)

  • Competitive infection assays (wild-type vs. mutant)

  • Histopathological assessment of infected tissues

Technical Considerations:

  • Biosafety: All experiments involving live B. abortus should be conducted in appropriate BSL-2 facilities following health and safety guidelines

  • Sample preparation: Optimize protocols for extraction of RNA or protein from infected cells while minimizing host contamination

  • Gene expression analysis: Consider normalization strategies for gene expression studies in infection settings

By carefully considering these factors, researchers can design robust experiments that provide meaningful insights into the role of aqpZ during B. abortus infection.

What are the considerations for generating and validating aqpZ mutants in Brucella abortus?

Generating and validating aqpZ mutants in Brucella abortus requires careful planning and rigorous validation. The following methodological considerations should guide this process:

Mutant Generation Strategies:

  • Gene Replacement/Deletion:

    • Design primers to amplify upstream and downstream regions of aqpZ

    • Introduce antibiotic resistance cassette between these regions

    • Use suicide vectors that cannot replicate in Brucella (e.g., pJQ200KS)

    • Select for double crossover events that result in gene replacement

  • Insertional Inactivation:

    • Generate an aqpX::lacZ gene fusion for both inactivation and expression studies

    • This approach has been successfully employed in previous studies

  • CRISPR-Cas9 Based Methods:

    • Design appropriate sgRNAs targeting aqpZ

    • Provide repair templates for precise genetic modifications

    • This approach allows for scarless mutations and multiple genetic manipulations

Validation Approaches:

  • Genetic Verification:

    • PCR verification of mutant construction

    • Sequencing to confirm precise genetic changes

    • Southern blot analysis to verify single integration events

  • Expression Analysis:

    • RT-PCR to confirm absence of aqpZ transcript

    • Western blot to verify absence of AqpZ protein

    • For lacZ fusions, β-galactosidase assays to confirm reporter function

  • Functional Validation:

    • Growth curves under standard conditions

    • Stress response assays, particularly under osmotic stress conditions

    • Complementation studies to verify that phenotypes are specifically due to aqpZ mutation

  • Phenotypic Characterization:

    • Monitor growth rates in rich and minimal media (expected to show no significant difference from wild-type)

    • Test survival in hypo-osmolar conditions (expected to show reduced viability after extended growth)

    • Assess response to hyperosmolar conditions

Complementation Strategy:

  • Clone the wild-type aqpZ gene into a Brucella-compatible expression vector

  • Reintroduce into the mutant strain

  • Verify expression of the complemented gene

  • Confirm restoration of wild-type phenotypes

These methodological considerations ensure that any phenotypes observed can be confidently attributed to the specific disruption of aqpZ function rather than to polar effects or secondary mutations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.