Recombinant Brucella abortus ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Brucella abortus ATP Synthase Subunit a (atpB)

The atpB gene encodes a 249-amino acid protein (UniProt ID: Q2YM92) that plays a central role in the bacterial ATP synthase complex. The recombinant form of this protein is produced in Escherichia coli with an N-terminal His-tag for purification purposes . Key identifiers include:

AttributeDetails
Gene NameatpB
SynonymsATP synthase subunit a, F₀ sector subunit a, F-ATPase subunit 6
Length249 amino acids (1–249 aa)
Expression HostE. coli
TagN-terminal His-tag
Purity>90% (SDS-PAGE)
StorageLyophilized powder stored at -20°C/-80°C

This recombinant protein is commercially available for research applications, including structural studies, biochemical assays, and vaccine development .

Expression and Purification Details

The recombinant atpB protein is expressed in E. coli systems optimized for high-yield production. Key steps in its preparation include:

  1. Cloning: The atpB gene is inserted into a plasmid vector under a promoter compatible with E. coli expression systems.

  2. Induction: Protein expression is induced using IPTG or similar agents.

  3. Purification: The His-tagged protein is purified via nickel-affinity chromatography, followed by desalting and lyophilization .

Vaccine Development

Although not directly tested as a vaccine candidate, subunit vaccines targeting Brucella proteins (e.g., Omp16, Omp19) have shown promise in eliciting Th1 immune responses . The atpB protein, as a conserved antigen, could theoretically be evaluated for immunogenicity in future studies.

Diagnostic Tools

Recombinant proteins like atpB are used in serological assays to detect Brucella-specific antibodies, though current diagnostic methods favor outer membrane proteins (OMPs) like Omp2a .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
atpB; BAB1_0411; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Brucella abortus (strain 2308)
Target Names
atpB
Target Protein Sequence
MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFAL SLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH
Uniprot No.

Target Background

Function
A key component of the proton channel, directly involved in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of ATP synthase in Brucella abortus?

ATP synthase in Brucella abortus is a double-motor enzyme that plays a critical role in energy metabolism by participating in ATP synthesis. Similar to ATP synthases in other bacteria, it consists of two main parts: F₀ (membrane-bound proton channel) and F₁ (catalytic domain). The subunit a (atpB) is an integral part of the F₀ complex and forms part of the ion channel that facilitates proton translocation across the membrane. The proton gradient drives the rotation of the central stalk, which induces conformational changes in the catalytic sites of the F₁ domain to synthesize ATP from ADP and inorganic phosphate .

How does the ATP synthase of Brucella abortus differ from other bacterial species?

While the core structure of ATP synthase is conserved across species, B. abortus ATP synthase exhibits unique characteristics that reflect its adaptation to intracellular survival. Unlike some bacteria that primarily use ATP synthase for energy production, Brucella's ATP synthase also appears to contribute to pathogenesis through mechanisms potentially related to pH homeostasis during intracellular trafficking. The subunit a (atpB) in Brucella contains specific amino acid sequences that may contribute to its function in the acidic environment of host cell compartments, although it shares conserved motifs with other alpha-proteobacteria such as Rhizobium meliloti .

Why is recombinant Brucella abortus ATP synthase subunit a important for research?

Recombinant B. abortus ATP synthase subunit a serves as a valuable tool for understanding the molecular mechanisms of Brucella pathogenesis and persistence. As an intracellular pathogen that causes brucellosis, B. abortus must adapt to various host environments, and its ATP synthase plays a crucial role in this adaptation. Studying the recombinant subunit allows researchers to:

  • Investigate structure-function relationships through site-directed mutagenesis

  • Develop potential vaccine candidates by creating attenuated strains

  • Identify novel drug targets for treating brucellosis

  • Understand bacterial energy metabolism during intracellular infection

What interactions exist between Brucella ATP synthase and host cell mechanisms during infection?

Brucella ATP synthase interacts with host cell mechanisms in several sophisticated ways during infection:

  • Endoplasmic Reticulum Stress Response: Brucella infection induces an Unfolded Protein Response (UPR) in host cells, which the bacterium exploits for intracellular replication. While ATP synthase is not directly implicated in UPR induction in the provided data, it likely contributes to the energy requirements needed for the bacterium to establish its replicative niche within the ER .

  • pH Adaptation: The proton-translocating function of ATP synthase (involving subunit a) may help Brucella survive the acidic environment of phagosomes during initial stages of infection.

  • Immune Response Modulation: Components of bacterial ATP synthase may act as pathogen-associated molecular patterns (PAMPs) that can potentially trigger or modulate host immune responses, although this appears to be counteracted by Brucella's immunomodulatory mechanisms .

How do inhibitors of ATP synthase affect Brucella abortus compared to other bacterial pathogens?

Various inhibitors affect ATP synthase across bacterial species with notable differences in their mechanisms and efficacy against B. abortus compared to other pathogens:

Inhibitor ClassEffect on B. abortusEffect on Other PathogensMechanism of Action
EfrapeptinsModerate inhibitionStrong in mitochondria, variable in bacteriaBinds to F₁ catalytic domain, prevents conformational changes
Polyphenolic compoundsNot well-characterized in BrucellaStrong inhibition in M. tuberculosisInteract with the c-ring of F₀
Organotin compoundsPotentially effectiveEffective against various bacteriaTarget ion channel within subunit a
Bedaquiline-like compoundsPotential therapeutic avenueEffective against M. tuberculosisBlock the rotation of the c-ring

The inhibitory profile of these compounds against B. abortus ATP synthase differs from that observed in other pathogens, potentially due to structural variations in the target binding sites. This differential sensitivity could be exploited for the development of Brucella-specific therapeutic agents .

What are the optimal conditions for expression and purification of recombinant B. abortus ATP synthase subunit a?

The expression and purification of recombinant B. abortus ATP synthase subunit a requires careful optimization due to the hydrophobic nature of this membrane protein. Based on established protocols for similar proteins:

Expression System Recommendations:

  • Bacterial Expression: E. coli BL21(DE3) with pET vector systems containing codon optimization for membrane proteins

  • Induction Conditions: 0.5 mM IPTG at 18-20°C for 16-18 hours to minimize inclusion body formation

  • Media Supplementation: Addition of 1% glucose to suppress basal expression and reduce toxicity

Purification Protocol:

  • Cell lysis using mild detergents (e.g., n-dodecyl β-D-maltoside or CHAPS)

  • Initial purification via Ni-NTA affinity chromatography if His-tagged

  • Size exclusion chromatography for further purification

  • Concentration in the presence of stabilizing agents to prevent aggregation

The hydrophobic nature of subunit a often results in lower yields compared to soluble proteins, typically in the range of 0.5-2 mg/L of bacterial culture. Western blotting with antibodies against conserved epitopes of ATP synthase subunit a can be used to verify protein identity and purity .

How can one evaluate the functionality of recombinant B. abortus ATP synthase subunit a in vitro?

Evaluating the functionality of recombinant B. abortus ATP synthase subunit a requires assessing both its structural integrity and functional capacity. Several complementary approaches are recommended:

  • Reconstitution Assays: Reconstitute the purified subunit a with other ATP synthase components in liposomes and measure ATP synthesis activity using luciferase-based assays.

  • Proton Translocation Studies: Monitor pH changes using pH-sensitive fluorescent dyes (e.g., ACMA or pyranine) to assess proton pumping activity when the reconstituted complex is energized.

  • Inhibitor Binding Studies: Evaluate binding of known ATP synthase inhibitors that target subunit a, such as organotin compounds, using fluorescence spectroscopy or isothermal titration calorimetry.

  • Structural Analysis: Examine secondary structure using circular dichroism spectroscopy to confirm proper folding, especially of transmembrane helices critical for function.

  • Site-Directed Mutagenesis: Create targeted mutations in key residues predicted to be involved in proton translocation and assess the impact on activity .

What strategies can be employed to create and validate atpB mutants in Brucella abortus?

Creating and validating atpB mutants in B. abortus requires specialized genetic approaches due to the pathogen's biosafety considerations and genetic manipulation challenges:

Mutant Construction Strategies:

  • Homologous Recombination: Using suicide plasmids containing flanking regions of the atpB gene with an antibiotic resistance marker. This approach allows for gene deletion or replacement.

  • CRISPR-Cas9 System: Recently adapted for Brucella, this system offers precise genetic modifications with higher efficiency than traditional methods.

  • Transposon Mutagenesis: For generating random insertional mutations, followed by screening for atpB disruptions.

Validation Methods:

  • Genomic Verification: Southern blot analysis and PCR to confirm gene replacement or deletion. For example, in the ExsA study cited, Southern blotting was used to demonstrate successful gene replacement in B. abortus .

  • Transcriptional Analysis: RT-PCR or RNA sequencing to confirm absence of atpB transcription or presence of modified transcripts.

  • Protein Expression Analysis: Western blotting with anti-atpB antibodies to confirm absence of the protein in deletion mutants.

  • Phenotypic Characterization:

    • Growth curve analysis in various media conditions

    • Intracellular survival in macrophage models

    • Virulence assessment in mouse models, measuring bacterial loads in spleen and liver at different time points post-infection .

  • Complementation Studies: Reintroduction of the wild-type atpB gene to restore function, confirming that observed phenotypes are specifically due to atpB mutation.

How can recombinant B. abortus ATP synthase subunit a be used for developing vaccination strategies?

Recombinant B. abortus ATP synthase subunit a offers several promising avenues for vaccine development against brucellosis:

  • Attenuated Live Vaccine Approach: Similar to findings with ExsA, atpB mutants may demonstrate attenuated virulence while maintaining immunogenicity. The ExsA deletion mutant induced greater protective immunity in BALB/c mice than the commercially available strain S19 vaccine, suggesting atpB mutants might have similar potential .

  • Subunit Vaccine Development: Purified recombinant atpB protein can be formulated with appropriate adjuvants to stimulate protective immunity without the risks associated with live organisms. Key considerations include:

    • Identification of immunodominant epitopes within atpB

    • Selection of adjuvants that promote appropriate Th1-biased immune responses

    • Delivery system optimization for antigen presentation

  • DNA Vaccine Approach: Plasmids encoding atpB can induce both humoral and cell-mediated immunity through in vivo expression of the antigen.

  • Prime-Boost Strategies: Combining different vaccine platforms (e.g., DNA vaccine prime followed by recombinant protein boost) to enhance protective efficacy.

Evaluation Protocol for Vaccine Candidates:

  • Measurement of antibody responses (IgG subtypes)

  • Assessment of cell-mediated immunity (IFN-γ, IL-2, TNF-α production)

  • Challenge studies in animal models with virulent B. abortus strains

  • Determination of bacterial loads in target organs following challenge

  • Comparison with existing vaccines (S19, RB51) as benchmarks

How does the study of B. abortus ATP synthase contribute to understanding bacterial adaptation during host infection?

The study of B. abortus ATP synthase provides critical insights into bacterial adaptation mechanisms during host infection:

  • Metabolic Adaptation: ATP synthase represents a key component in the metabolic shift that occurs when Brucella transitions from extracellular to intracellular environments. The bacterium must adapt its energy production strategies to utilize available resources within host cells, and ATP synthase modulation appears central to this process.

  • pH Homeostasis: As Brucella traffics through various intracellular compartments with different pH environments, ATP synthase (particularly subunit a) likely plays a crucial role in maintaining internal pH homeostasis, which is essential for protein function and cellular processes.

  • Stress Response Coordination: The bacterium's ability to induce and potentially exploit host stress responses like the Unfolded Protein Response (UPR) involves sophisticated energy management, with ATP synthase providing the necessary energy for these adaptations .

  • Persistent Infection Mechanisms: The long-term survival of Brucella within host cells requires sustainable energy production with minimal host damage, and ATP synthase function likely contributes to this balanced parasitism.

Understanding these adaptation mechanisms can inform broader concepts in host-pathogen interactions and potentially reveal common strategies employed by intracellular pathogens .

What structural and functional differences exist between B. abortus ATP synthase and human mitochondrial ATP synthase that could be exploited for drug development?

Several key structural and functional differences between B. abortus ATP synthase and human mitochondrial ATP synthase offer potential targets for selective therapeutic intervention:

FeatureB. abortus ATP SynthaseHuman Mitochondrial ATP SynthasePotential for Exploitation
Subunit CompositionSimpler structure with fewer accessory subunitsComplex structure with numerous regulatory subunitsBacterial-specific subunits as drug targets
Inhibitor SensitivityDifferential sensitivity to inhibitors like efrapeptinsHigh sensitivity to oligomycin and other specific inhibitorsExploitation of differential inhibitor binding sites
c-ring StoichiometryTypically 10-14 c subunits8 c subunitsDifferent coupling ratios offering selective targeting
Regulatory MechanismsLess complex regulationHighly regulated by multiple factorsDisruption of bacterial-specific regulatory mechanisms
Ion SpecificityPrimarily H⁺-specificExclusively H⁺-specificPotential exploitation of subtle differences in the proton channel

These differences, particularly in the transmembrane domains of subunit a where proton translocation occurs, could be exploited to develop drugs that selectively inhibit the bacterial enzyme without affecting the human counterpart, thereby minimizing side effects .

How can structural analysis of recombinant B. abortus ATP synthase subunit a inform inhibitor design?

Structural analysis of recombinant B. abortus ATP synthase subunit a can significantly advance inhibitor design through multiple approaches:

  • Key Residue Identification: Detailed structural characterization can identify critical residues involved in proton translocation that differ from human homologs. These residues, particularly in the transmembrane helices of subunit a, can serve as specific targets for rational drug design.

  • Binding Pocket Mapping: Identification of unique binding pockets within the B. abortus ATP synthase structure, especially at the interface between subunit a and the c-ring, can facilitate the design of inhibitors that selectively bind to these regions. Molecular docking studies with existing inhibitors like organotin compounds can provide initial insights into these binding interactions .

  • Structure-Based Optimization: Once lead compounds are identified, structural information can guide systematic modification to enhance binding affinity and specificity. For example, understanding the structural basis for efrapeptin binding could lead to the development of derivatives with enhanced selectivity for bacterial ATP synthases .

  • Allosteric Site Exploration: Beyond the active site, structural analysis may reveal allosteric sites unique to bacterial ATP synthases that could be targeted to disrupt enzyme function without directly competing with substrate binding.

  • Fragment-Based Approaches: Structural information enables fragment-based drug discovery approaches, where small molecular fragments are identified as weak binders and subsequently linked or elaborated to create high-affinity inhibitors.

What novel approaches could enhance our understanding of B. abortus ATP synthase in pathogenesis?

Several cutting-edge approaches could significantly advance our understanding of B. abortus ATP synthase's role in pathogenesis:

  • Single-Cell Analysis: Applying techniques like single-cell RNA sequencing to infected host cells could reveal heterogeneity in ATP synthase expression and activity during different stages of infection, potentially identifying subpopulations of bacteria with distinct metabolic profiles.

  • Real-Time Imaging: Development of fluorescent reporters linked to ATP synthase activity or conformation would allow dynamic visualization of energy metabolism during intracellular infection, revealing temporal and spatial regulation patterns.

  • Cryo-Electron Microscopy: High-resolution structural studies of the complete B. abortus ATP synthase complex could reveal species-specific features and conformational states relevant to function during infection.

  • Metabolic Flux Analysis: Using stable isotope labeling to track metabolic pathways connected to ATP synthase activity would provide insights into how energy production changes during different phases of the infection cycle.

  • Systems Biology Integration: Combining transcriptomics, proteomics, and metabolomics data to build comprehensive models of how ATP synthase fits into the broader adaptive responses of B. abortus during infection .

  • CRISPR Interference Applications: Using CRISPRi to create conditional knockdowns of atpB could allow temporal control over ATP synthase function, enabling precise determination of when it is most critical during infection.

How might ATP synthase inhibitors be incorporated into combination therapies for brucellosis?

ATP synthase inhibitors could transform brucellosis treatment through strategic integration into combination therapies:

  • Synergistic Combinations: Pairing ATP synthase inhibitors with conventional antibiotics may yield synergistic effects, allowing lower doses of both agents while maintaining efficacy. For example, combining ATP synthase inhibitors with doxycycline or rifampin (current first-line treatments) could enhance bacterial clearance by simultaneously targeting energy production and other essential functions.

  • Sequential Administration Protocols: Implementing time-staggered administration where ATP synthase inhibitors first compromise bacterial energy metabolism, followed by conventional antibiotics to eliminate weakened bacteria, could improve treatment outcomes.

  • Targeting Persistent Infection: ATP synthase inhibitors may be particularly valuable for eliminating persistent Brucella populations that conventional antibiotics fail to clear. These inhibitors could target the energy production necessary for long-term survival in host niches.

  • Host-Directed Therapy Combinations: Combining ATP synthase inhibitors with agents that modulate host responses (like UPR modulators) could simultaneously target bacterial energy production and the host environments that Brucella exploits. For instance, tauroursodeoxycholic acid, which ameliorates the UPR, has been shown to impair Brucella replication in macrophages .

  • Biofilm Disruption: If Brucella forms biofilm-like structures during chronic infection, ATP synthase inhibitors could reduce the metabolic activity needed for biofilm maintenance, making bacteria more susceptible to conventional antibiotics.

What role might post-translational modifications of ATP synthase play in Brucella virulence and adaptation?

Post-translational modifications (PTMs) of ATP synthase likely play crucial but understudied roles in Brucella virulence and adaptation:

  • Phosphorylation: Reversible phosphorylation of ATP synthase subunits could serve as a rapid regulatory mechanism to adjust energy production in response to environmental changes during infection. Kinases and phosphatases likely modulate ATP synthase activity as the bacterium transitions between different intracellular compartments.

  • Acetylation: Lysine acetylation, which has been observed in bacterial ATP synthases, may fine-tune enzyme activity in response to nutrient availability within the host cell environment.

  • Oxidative Modifications: As Brucella encounters oxidative stress within phagocytes, redox-sensitive modifications of ATP synthase could serve as both damage indicators and adaptive responses to maintain function under stress conditions.

  • Proteolytic Processing: Controlled proteolysis might regulate ATP synthase assembly or generate functional variants adapted to specific intracellular niches.

  • Bacterial Effector-Mediated Modifications: Brucella effector proteins, potentially including TcpB which affects host microtubules and ER structure, might directly modify ATP synthase to optimize its function during intracellular replication .

Research approaches to investigate these PTMs could include mass spectrometry-based proteomics to identify modification sites, combined with site-directed mutagenesis to assess their functional significance in infection models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.