Recombinant Brucella abortus ATP synthase subunit b 1 (atpF1)

Shipped with Ice Packs
In Stock

Description

Introduction

Brucella abortus is a bacterium that causes brucellosis, a zoonotic disease affecting livestock and humans . ATP synthase subunit b 1 (atpF1) is a component of the ATP synthase complex, which is essential for energy production in bacteria . Recombinant atpF1 is produced using genetic engineering techniques, where the gene encoding atpF1 from B. abortus is inserted into a host organism (e.g., E. coli) to produce large quantities of the protein . This recombinant protein can then be used for various research and biotechnological applications .

Characteristics of Brucella abortus ATP Synthase Subunit b 1 (atpF1)

CharacteristicDescription
Protein NameATP synthase subunit b 1 (atpF1)
Source OrganismBrucella abortus
Molecular WeightInformation not available in the provided documents.
Amino Acid Length208 aa
Expression HostE. coli
TagN-terminal His tag
FunctionComponent of the ATP synthase complex, essential for energy production
ApplicationsVaccine development, diagnostics, and immunological studies

Research Applications

Recombinant Brucella abortus atpF1 has several potential applications in brucellosis research:

  • Vaccine Development: Subunit vaccines based on recombinant proteins like atpF1 can stimulate Th1 type immunity and provide protection against B. abortus . Immunization with recombinant proteins can induce high levels of specific IgG and cytokines associated with Th1 type immune response, protecting against B. abortus .

  • Diagnostic Assays: Recombinant atpF1 can be used to develop diagnostic assays for brucellosis, allowing for the detection of antibodies against B. abortus in infected animals .

  • Immunological Studies: Recombinant atpF1 can be used to study the immune responses to B. abortus, including the identification of specific T-cell epitopes and the mechanisms of immune protection .

Attenuated Mutants

Studies have explored the creation of attenuated B. abortus strains through gene deletions, including those involved in ATP synthesis. Deletion of ATP/GDP-binding protein motif A (p-loop) and ATP-binding/permease protein (cyd C) in B. abortus produces attenuated mutants that cannot replicate intracellularly, showing potential as vaccine candidates .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
atpF1; BAbS19_I03820; ATP synthase subunit b 1; ATP synthase F(0 sector subunit b 1; ATPase subunit I 1; F-type ATPase subunit b 1; F-ATPase subunit b 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Brucella abortus (strain S19)
Target Names
atpF1
Target Protein Sequence
MFVSTAFAQTATESQPASTAGEHGAADAVHTETGVAHDAGHGSGVFPPFDSTHYASQVLW LAITFGLFYLFLSRVVLPRIGGVIETRRDRIAQDLEQAARLKQDADNAIAAYEQELAQAR SKAASIAEAAREKGKGEADAERASAEAVLESKLKEAEERIAAIKAKAMSDVGNIAEETTA TIVEQLLGLTADKASVSEAVKAIRASNA
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These are linked by a central and a peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation through a rotary mechanism involving the central stalk subunits.

This product is a component of the F0 channel, forming part of the peripheral stalk and linking F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Brucella abortus ATP synthase subunit b 1 (atpF1)?

Brucella abortus ATP synthase subunit b 1 (atpF1) is a component of the bacterial F0F1 ATP synthase complex, specifically located in the F0 sector embedded within the bacterial membrane. This protein functions as part of the stator that connects the membrane-embedded F0 sector with the catalytic F1 sector. The b subunit in Brucella species is structurally similar to that found in other bacterial ATP synthases, containing a membrane-spanning N-terminal domain and an extended alpha-helical domain that interacts with the F1 sector . Current research indicates that atpF1 in Brucella abortus is approximately 17-20 kDa in size and plays a critical role in maintaining the structural integrity of the ATP synthase complex.

What is the role of ATP synthase in Brucella survival and pathogenesis?

ATP synthase serves dual critical functions in Brucella abortus:

  • Energy production: As the terminal enzyme of the oxidative phosphorylation pathway, ATP synthase generates ATP by utilizing the proton gradient across the bacterial membrane, providing energy for essential cellular processes .

  • Pathogenesis support: ATP synthase activity is essential for Brucella's intracellular survival by maintaining energy production during infection. Recent studies suggest that ATP synthase components, including atpF1, may contribute to Brucella's ability to establish its replicative niche within host cells . The protein supports the bacterium's adaptation to the challenging intracellular environment, particularly during the late stages of infection when Brucella manipulates host cell machinery for egress and dissemination .

ATP synthase inhibition in bacterial pathogens has proven to be a successful therapeutic strategy, as demonstrated by bedaquiline's effectiveness against Mycobacterium tuberculosis . Similar approaches could potentially be developed for brucellosis treatment.

How does the structure of atpF1 in Brucella compare to other bacterial species?

The ATP synthase b subunit (atpF1) shows considerable structural conservation across bacterial species, but with key differences that may be relevant to pathogenesis:

FeatureBrucella abortus atpF1E. coli atpFMycobacterial atpF
Size~17-20 kDa~17 kDa~18 kDa
Membrane-spanning domainsSingle N-terminal domainSingle N-terminal domainSingle N-terminal domain
C-terminal structureAlpha-helical, interacts with delta subunitAlpha-helical, interacts with delta subunitModified C-terminal region
DimerizationForms homodimerForms homodimerForms homodimer
Species-specific featuresContains Brucella-specific epitopesStandard bacterial featuresDrug-binding pocket (BDQ target region)

While the core structure remains conserved, Brucella atpF1 contains unique amino acid sequences that could be exploited for species-specific detection and targeting . Unlike the mycobacterial ATP synthase that has been crystallized and studied in complex with inhibitors like bedaquiline , the detailed three-dimensional structure of Brucella ATP synthase components remains to be fully elucidated.

What biochemical characteristics distinguish Brucella ATP synthase from host ATP synthase?

Brucella ATP synthase exhibits several distinctive features compared to mammalian mitochondrial ATP synthase:

  • Subunit composition: Bacterial ATP synthases, including Brucella's, contain subunits not present in mammalian counterparts, making them potential therapeutic targets .

  • Inhibitor sensitivity: Brucella ATP synthase shows differential sensitivity to inhibitors compared to mammalian ATP synthase, offering potential selective targeting opportunities .

  • Membrane association: Unlike eukaryotic ATP synthase that resides in the inner mitochondrial membrane, bacterial ATP synthase integrates directly into the cell membrane, affecting its biophysical properties and interaction with the environment .

These differences provide opportunities for developing targeted therapeutic approaches with minimal host toxicity.

What expression systems are most effective for producing recombinant Brucella abortus atpF1?

Based on current research protocols, the following expression systems have been employed for recombinant Brucella ATP synthase components:

  • E. coli expression system: The most widely used approach for Brucella proteins utilizes E. coli BL21(DE3) with pET vectors (typically pET28a) . Expression is generally induced with IPTG (0.5-1.0 mM) at lower temperatures (16-25°C) to enhance proper folding.

  • Optimized protocols include:

    • Using E. coli strains with rare codon plasmids (e.g., Rosetta)

    • Induction at OD600 of 0.6-0.8

    • Extended expression times (16-20 hours) at reduced temperature (16°C)

    • Inclusion of chaperones to improve folding

  • Yield enhancement strategies:

    • Codon optimization for E. coli expression

    • Using fusion tags (His6, MBP, or GST) to improve solubility

    • Testing multiple construct designs with varying N- and C-terminal boundaries

The E. coli host remains the preferred expression system due to its established protocols, although challenges with membrane protein expression often require optimization .

How can recombinant atpF1 be purified while maintaining its structural integrity?

Purification of recombinant Brucella atpF1 requires careful handling due to its membrane association properties:

  • Standard purification protocol:

    • Bacterial cell lysis using sonication or French press in buffer containing detergents (typically CHAPS or n-dodecyl-β-D-maltoside)

    • Immobilized metal affinity chromatography (IMAC) using nickel or cobalt resins for His-tagged proteins

    • Size exclusion chromatography for final polishing and buffer exchange

    • Maintaining reducing conditions with DTT or β-mercaptoethanol throughout purification

  • Critical considerations:

    • Detergent selection is crucial, as it must solubilize the protein without denaturing it

    • Temperature control (4°C) throughout the purification process

    • Inclusion of protease inhibitors to prevent degradation

    • Careful buffer selection with stabilizing agents (glycerol 10-20%)

  • Validation methods:

    • SDS-PAGE and Western blotting to confirm purity and identity

    • Circular dichroism to verify secondary structure

    • Size exclusion chromatography to assess oligomeric state

    • Limited proteolysis to evaluate structural integrity

What assays can evaluate the enzymatic activity of recombinant Brucella ATP synthase components?

Multiple approaches have been developed to assess ATP synthase activity, adaptable for Brucella components:

  • ATP synthesis activity assay:

    • Luciferin/luciferase-based continuous measurement of ATP production

    • Inverted membrane vesicles (IMVs) containing ATP synthase complex

    • Monitoring ATP synthesis initiated by creating a proton gradient with succinate

  • ATP hydrolysis assay:

    • Measurement of inorganic phosphate release using malachite green or other colorimetric methods

    • Coupled enzyme assays linking ATP hydrolysis to NADH oxidation

    • pH-based assays measuring proton release during ATP hydrolysis

  • Proton pumping assays:

    • Using pH-sensitive fluorescent dyes (ACMA or pyranine)

    • Monitoring membrane potential with voltage-sensitive dyes

Research with mycobacterial ATP synthase has demonstrated that a combination of these approaches provides complementary information about enzyme function . Similar methodologies can be applied to Brucella ATP synthase components.

How can researchers investigate atpF1 interactions with other ATP synthase subunits?

Studying protein-protein interactions within the ATP synthase complex requires specialized techniques:

  • In vitro interaction studies:

    • Pull-down assays using purified recombinant components

    • Surface plasmon resonance (SPR) for binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters

    • Cross-linking studies followed by mass spectrometry

  • Structural approaches:

    • X-ray crystallography of co-crystallized components

    • Cryo-electron microscopy of reconstituted complexes

    • NMR studies for smaller subunits and interaction domains

  • In vivo approaches:

    • Bacterial two-hybrid systems

    • FRET-based interaction studies in live bacteria

    • Co-immunoprecipitation from bacterial lysates

Previous studies with bacterial ATP synthases provide templates for these methodologies , though the complete Brucella ATP synthase structure remains to be determined.

How does atpF1 contribute to Brucella virulence and host cell interaction?

While direct evidence for atpF1's role in virulence is still emerging, several aspects highlight its importance:

  • Energy provision for virulence mechanisms: ATP synthase activity is crucial for powering Brucella's type IV secretion system (T4SS), which is essential for intracellular survival and virulence .

  • Adaptation to intracellular environment: ATP synthesis supports bacterial adaptation to nutrient-limited intracellular niches during infection.

  • Potential role in stress responses: ATP synthase components may contribute to acid stress resistance, important for Brucella survival during host cell entry.

  • Connection to mitochondrial interactions: Recent research indicates that Brucella interacts with host mitochondria, potentially involving bacterial ATP synthase components. Brucella has been shown to induce BNIP3L-mediated mitophagy, which is required for bacterial egress from host cells . This process involves HIF-1α stabilization and may connect to energy metabolism pathways.

What experimental approaches can assess atpF1's role in Brucella pathogenesis?

Several experimental strategies can elucidate atpF1's function in pathogenesis:

  • Genetic approaches:

    • Construction of conditional knockdown mutants (as complete deletion may be lethal)

    • Site-directed mutagenesis of key residues

    • Complementation studies

  • Cellular infection models:

    • Macrophage infection assays with wild-type and mutant strains

    • Intracellular trafficking studies using fluorescence microscopy

    • Host cell response monitoring (transcriptomics/proteomics)

  • Biochemical approaches:

    • ATP synthesis measurement during different infection stages

    • Monitoring protein expression and modification during infection

    • Protein-protein interaction studies under infection-relevant conditions

  • In vivo models:

    • Mouse infection models comparing atpF1 mutants with wild-type bacteria

    • Tissue-specific analyses of bacterial fitness and host responses

How can recombinant atpF1 be employed in brucellosis diagnostics?

Recombinant Brucella ATP synthase components show potential for diagnostic applications:

  • Serological detection:

    • Indirect ELISA using purified recombinant atpF1 to detect Brucella-specific antibodies in patient sera

    • Multiplex assays combining atpF1 with other Brucella antigens

Studies with other Brucella components have demonstrated that recombinant proteins can achieve high sensitivity and specificity in serological assays. For example, research on T4SS proteins revealed sensitivity and specificity exceeding 0.9100 and 0.9167, respectively .

  • Protein microarrays:

    • Including recombinant atpF1 in comprehensive Brucella antigen arrays

    • Profiling antibody responses for diagnosis and disease staging

  • Lateral flow assays:

    • Developing point-of-care tests using recombinant atpF1

    • Combining with other antigens for improved accuracy

  • PCR-based detection:

    • Using atpF1 gene sequences for molecular diagnosis

    • Development of multiplex PCR targeting ATP synthase genes

What are the prospects for developing ATP synthase-targeted therapeutics against Brucella?

ATP synthase represents a promising therapeutic target as demonstrated by success with mycobacterial infections:

  • Inhibitor development strategy:

    • Structure-based drug design targeting Brucella-specific features of ATP synthase

    • High-throughput screening of compound libraries against recombinant atpF1

    • Repurposing existing ATP synthase inhibitors with demonstrated antimicrobial activity

  • Challenges and considerations:

    • Ensuring specificity for bacterial versus host ATP synthase

    • Optimizing membrane permeability of inhibitor compounds

    • Addressing potential toxicity concerns as seen with other ATP synthase inhibitors

  • Combination approaches:

    • Using ATP synthase inhibitors alongside conventional antibiotics

    • Targeting multiple Brucella-specific proteins to prevent resistance development

The success of bedaquiline against Mycobacterium tuberculosis by targeting ATP synthase provides a precedent for this approach .

What are the challenges in structural studies of Brucella ATP synthase components?

Structural characterization of Brucella ATP synthase faces several technical challenges:

  • Crystallization difficulties:

    • Membrane proteins are notoriously difficult to crystallize

    • The dynamic nature of ATP synthase components complicates structure determination

    • Finding appropriate detergents that maintain native conformation

  • Alternative approaches:

    • Cryo-electron microscopy for whole complex visualization

    • NMR studies of individual domains

    • Molecular dynamics simulations based on homology models

    • Hydrogen-deuterium exchange mass spectrometry for conformational insights

  • Future directions:

    • Using nanodiscs or amphipols to stabilize membrane components

    • Applying advanced fragment-based crystallography

    • Leveraging AlphaFold and other AI-based structure prediction tools

Recent advances in membrane protein structural biology provide new opportunities for studying these challenging proteins .

How can researchers address the challenge of functional reconstitution of Brucella ATP synthase?

Reconstituting functional ATP synthase represents a significant challenge:

  • Reconstitution strategies:

    • Proteoliposome preparation with defined lipid composition

    • Co-expression of multiple subunits using multi-cistronic vectors

    • Step-wise assembly of subcomplexes followed by integration

  • Functional validation:

    • ATP synthesis measurement in reconstituted systems

    • Proton pumping assays with pH-sensitive dyes

    • Structural integrity assessment through electron microscopy

  • Potential innovations:

    • Nanodiscs for studying ATP synthase in a membrane-like environment

    • Cell-free expression systems for direct incorporation into liposomes

    • Microfluidic approaches for high-throughput optimization

The complexity of ATP synthase makes functional reconstitution technically demanding but potentially highly informative for understanding Brucella bioenergetics.

What emerging technologies could advance our understanding of Brucella ATP synthase dynamics?

Recent technological advances offer new opportunities:

  • Single-molecule techniques:

    • High-speed atomic force microscopy to visualize ATP synthase rotation

    • Single-molecule FRET to track conformational changes

    • Optical tweezers to measure force generation

  • Advanced imaging:

    • Super-resolution microscopy to visualize ATP synthase distribution in bacteria

    • Correlative light and electron microscopy for structural-functional studies

    • Cryo-electron tomography of intact bacterial cells

  • Systems biology approaches:

    • Multi-omics integration to understand ATP synthase in cellular context

    • Metabolic flux analysis to quantify ATP synthase contribution to energy metabolism

    • Network modeling of ATP synthase interactions within Brucella physiology

These emerging technologies promise to reveal dynamic aspects of ATP synthase function that remain inaccessible to traditional structural and biochemical methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.