Recombinant Brucella abortus Beta- (1-->2)glucan export ATP-binding/permease protein NdvA (ndvA)

Shipped with Ice Packs
In Stock

Description

Role in Brucella Pathogenesis

NdvA is essential for B. abortus virulence due to its role in cyclic β-1,2-glucan export:

  • Intracellular Survival: Mutants lacking cgt/ndvA exhibit defective replication in macrophages (HeLa and J774 cells) and reduced survival in mouse models .

  • Lipopolysaccharide (LPS) Stability: Disruption of ndvA alters smooth LPS profiles, leading to a rough phenotype and impaired evasion of host immunity .

  • ERAD Pathway Inhibition: NdvA homologs (e.g., BspA) interfere with the host endoplasmic reticulum-associated degradation (ERAD) pathway, promoting bacterial replication .

3.1. Genetic and Functional Studies

  • Complementation Assays: B. abortus ndvA restores cyclic glucan transport in S. meliloti ndvA and A. tumefaciens chvA mutants, rescuing motility, tumor induction, and nodule occupancy .

  • ERAD Interaction: BspA, a Type IV effector related to NdvA, destabilizes the MARCH6 E3 ligase complex, inhibiting ERAD and enhancing bacterial growth in macrophages .

3.2. Vaccine Development Potential

While NdvA itself is not yet a vaccine candidate, studies highlight the efficacy of multi-subunit vaccines containing other Brucella proteins (e.g., L7/L12, Omp16/19/28) in eliciting Th1 immune responses and reducing bacterial loads in mice . NdvA’s role in glucan transport positions it as a potential target for virulence-blocking therapies.

Applications in Biomedical Research

  • Virulence Studies: Used to dissect mechanisms of intracellular survival and immune evasion .

  • Protein Interaction Analysis: Employed to study host-pathogen interactions, particularly ERAD pathway modulation .

  • Reagent Availability: Commercially available for research (e.g., Creative Biolabs, Cusabio) .

Challenges and Future Directions

  • Structural Insights: Further crystallography studies are needed to resolve NdvA’s ATP-binding and glucan-translocation mechanisms.

  • Therapeutic Targeting: Small-molecule inhibitors disrupting NdvA’s ATPase activity could neutralize Brucella virulence.

  • Vaccine Adjuvants: Cyclic β-1,2-glucan, transported by NdvA, may enhance antigen presentation in subunit vaccines .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we currently have in stock. However, if you require a specific format, please indicate your preference in the order remarks, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
ndvA; cgt; BAB1_1017; Beta-(1-->2glucan export ATP-binding/permease protein NdvA
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-599
Protein Length
full length protein
Species
Brucella abortus (strain 2308)
Target Names
ndvA
Target Protein Sequence
MSLLKIYWRAMQYLAVERTATITMCVASVLVALVTLAEPVLFGRVIQSISDKGDIFSPLL MWAALGGFNIMAAVFVARGADRLAHRRRLGVMIDSYERLITMPLAWHQKRGTSNALHTLI RATDSLFTLWLEFMRQHLTTVVALATLIPVAMTMDMRMSLVLIVLGVIYVMIGQLVMRKT KDGQAAVEKHHHKLFEHVSDTISNVSVVQSYNRIASETQALRDYAKNLENAQFPVLNWWA LASGLNRMASTFSMVVVLVLGAYFVTKGQMRVGDVIAFIGFAQLMIGRLDQISAFINQTV TARAKLEEFFQMEDATADRQEPENVADLNDVKGDIVFDNVTYEFPNSGQGVYDVSFEVKP GQTVAIVGPTGAGKTTLINLLQRVFDPAAGRIMIDGTDTRTVSRRSLRHAIATVFQDAGL FNRSVEDNIRVGRANATHEEVHAAAKAAAAHDFILAKSEGYDTFVGERGSQLSGGERQRL AIARAILKDSPILVLDEATSALDVETEEKVTQAVDELSHNRTTFIIAHRLSTVRSADLVL FMDKGHLVESGSFNELAERGGRFSDLLRAGGLKLEDKQPKQPVVEGSNVMPFPVKGAVA
Uniprot No.

Target Background

Function
Involved in beta-(1-->2)glucan export. Its export to the periplasmic space is required for its function as a virulence factor. Transmembrane domains (TMD) form a pore in the inner membrane, and the ATP-binding domain (NBD) is likely responsible for energy generation.
Database Links
Protein Families
ABC transporter superfamily, Beta-(1-->2)glucan exporter (TC 3.A.1.108.1) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the NdvA protein and what is its function in Brucella abortus?

The NdvA protein in Brucella abortus functions as an ATP-binding/permease protein responsible for the export of cyclic beta-(1-->2)glucan across the bacterial cell membrane. Based on homology studies, NdvA is a 67,100-dalton protein that shares significant structural and functional similarities with bacterial ATP-binding transport proteins, particularly with Escherichia coli HlyB (involved in hemolysin export) and the mdr gene product in mammalian cells . The protein belongs to the ABC transporter superfamily and couples ATP hydrolysis to the active transport of beta-(1-->2)glucan, which is critical for bacterial cell envelope integrity, host-pathogen interactions, and successful colonization during infection.

How does NdvA compare to homologous proteins in other bacterial species?

The NdvA protein in B. abortus demonstrates significant homology to the NdvA protein in Rhizobium meliloti and can functionally substitute for the ChvA locus in Agrobacterium tumefaciens . This homology extends to the protein's core functional domains, particularly the ATP-binding cassette (ABC) and transmembrane domains. Studies of ndvA mutants in R. meliloti have shown that these mutants exhibit reduced motility and form small, white, empty nodules on alfalfa roots, indicating the protein's essential role in symbiotic relationships . The high degree of conservation across different bacterial species suggests that beta-(1-->2)glucan export is a fundamental process in various plant-associated bacteria and pathogens.

What is the relationship between NdvA function and Brucella virulence?

NdvA plays a significant role in Brucella virulence through its essential function in exporting beta-(1-->2)glucan, which affects multiple aspects of pathogenesis:

  • Cell envelope integrity: Proper beta-(1-->2)glucan export maintains the bacterial cell envelope structure necessary for survival within host cells

  • Immune modulation: Beta-(1-->2)glucan can interact with host immune receptors, potentially modulating host immune responses

  • Intracellular survival: The export of beta-(1-->2)glucan is critical for adaptation to the intracellular environment

  • Host colonization: Mutants defective in beta-(1-->2)glucan export show reduced ability to establish infections

Understanding this relationship provides insights into potential targets for vaccine development and therapeutic interventions against brucellosis .

What expression systems are most effective for recombinant NdvA production?

The optimal expression of recombinant NdvA requires careful consideration of expression systems due to its nature as a membrane-associated protein:

  • E. coli-based expression systems:

    • BL21(DE3) strains with pET vectors for high expression levels

    • C41(DE3) or C43(DE3) strains specifically designed for membrane protein expression

    • pCold-TF vector system, which has demonstrated success with other Brucella recombinant proteins

  • Alternative expression hosts:

    • Yeast systems (Pichia pastoris) for proper protein folding

    • Insect cell systems for complex membrane proteins

Key optimization parameters include:

  • Induction temperature (typically 16-20°C for membrane proteins)

  • IPTG concentration (0.1-0.5 mM)

  • Expression duration (4-24 hours)

  • Addition of solubility enhancers (glycerol, specific detergents)

Researchers should validate expression through immunoblotting assays, which have successfully detected recombinant Brucella proteins using Brucella-positive serum .

What purification strategies yield the highest purity recombinant NdvA protein?

Purification of recombinant NdvA requires specialized approaches for membrane proteins:

Purification StepMethodologyOptimization Parameters
Membrane ExtractionDifferential centrifugationBuffer composition, detergent selection
SolubilizationDetergent screeningDetergent type (DDM, LMNG, CHAPS), concentration
Affinity ChromatographyIMAC with His-tagImidazole concentration, flow rate
Size ExclusionSuperdex 200Buffer optimization, detergent concentration
Functional ValidationATPase activity assaySubstrate concentration, temperature

Critical considerations include:

  • Detergent selection is crucial for maintaining NdvA stability and activity

  • Addition of glycerol (10-15%) in all buffers enhances protein stability

  • Inclusion of ATP or non-hydrolyzable analogs during purification may stabilize the protein

  • Quality assessment should include SDS-PAGE, Western blotting, and functional assays

How can researchers verify proper folding and activity of recombinant NdvA?

Verification of recombinant NdvA structural integrity and activity should include:

  • Structural assessment:

    • Circular dichroism (CD) spectroscopy to evaluate secondary structure

    • Thermal shift assays to assess protein stability

    • Limited proteolysis to confirm proper domain organization

  • Functional validation:

    • ATPase activity using colorimetric phosphate release assays

    • ATP binding assays using fluorescent ATP analogs

    • Transport activity in reconstituted proteoliposomes

  • Protein-protein interaction studies:

    • Pull-down assays with known interaction partners

    • Co-immunoprecipitation to identify native interactors

These validation steps are essential before proceeding to more complex experimental applications with the recombinant protein.

What assays can be used to evaluate NdvA transport activity?

Evaluating the transport activity of recombinant NdvA requires specialized techniques:

  • Liposome reconstitution assays:

    • Incorporation of purified NdvA into artificial lipid vesicles

    • Loading vesicles with fluorescently labeled beta-(1-->2)glucan

    • Measuring substrate transport using fluorescence-based detection methods

  • Cell-based transport assays:

    • Complementation studies in ndvA-deficient bacterial mutants

    • Quantification of extracellular versus intracellular beta-(1-->2)glucan levels

    • Monitoring the restoration of phenotypes in complemented strains

  • ATP hydrolysis coupling:

    • Assessment of ATPase activity in the presence and absence of substrate

    • Determination of the coupling ratio between ATP hydrolysis and substrate transport

    • Evaluation of the effects of inhibitors on transport activity

These assays provide direct functional evidence for NdvA's role in beta-(1-->2)glucan export and can be used to evaluate the effects of mutations or potential inhibitors.

How can mutagenesis be applied to study NdvA structure-function relationships?

A systematic mutagenesis approach for NdvA structure-function analysis should include:

  • Targeted mutations of key functional domains:

    • Walker A and Walker B motifs in the ATP-binding domain

    • Conserved residues in the transmembrane helices

    • Putative substrate-binding sites

  • Domain swapping experiments:

    • Exchange of domains with homologous transporters

    • Creation of chimeric proteins to identify specificity determinants

  • Analysis methodology:

    • Comparative expression and stability analysis

    • Transport activity measurements

    • ATP binding and hydrolysis assays

DomainKey Residues for MutationExpected Effect
Walker AK45A (example)Impaired ATP binding
Walker BE165Q (example)ATP binding without hydrolysis
TransmembraneConserved charged residuesAltered substrate specificity
Coupling helicesInterface residuesDisrupted NBD-TMD communication

Results from such mutagenesis studies can provide detailed insights into the molecular mechanisms of NdvA-mediated transport.

What techniques can be used to study NdvA interactions with other cellular components?

Understanding NdvA's interaction network requires multiple complementary approaches:

  • Co-immunoprecipitation:

    • Using antibodies against recombinant NdvA to pull down interaction partners

    • Mass spectrometry identification of co-precipitated proteins

    • Validation of interactions through reciprocal pull-downs

  • Crosslinking studies:

    • Chemical crosslinking of protein complexes in native membranes

    • Site-specific photocrosslinking to identify precise interaction interfaces

    • Mass spectrometry analysis of crosslinked peptides

  • Microscopy-based techniques:

    • Fluorescence co-localization studies using tagged proteins

    • FRET analysis to quantify protein-protein interactions

    • Super-resolution microscopy for detailed localization

  • Protein interaction screening:

    • Bacterial two-hybrid systems for systematic interaction mapping

    • Protein fragment complementation assays in live cells

These techniques can reveal how NdvA functions within the broader context of bacterial physiology and beta-(1-->2)glucan export.

How can recombinant NdvA be utilized in vaccine development strategies?

Recombinant NdvA has several potential applications in Brucella vaccine development:

  • Subunit vaccine development:

    • Inclusion in multi-component vaccines alongside other protective antigens

    • Combination with established immunogens such as Omp16, Omp19, Omp28, and L7/L12

    • Formulation with appropriate adjuvants to direct immune responses

  • Immunological evaluation:

    • Assessment of NdvA-specific antibody responses

    • Characterization of T-cell epitopes and cellular immunity

    • Evaluation of protective efficacy in animal models

  • Vaccine delivery platforms:

    • Incorporation into novel delivery systems

    • Development of DNA vaccines encoding NdvA

    • Viral vector-based expression systems

Research has shown that combined subunit vaccines using multiple Brucella proteins can induce strong protective effects against B. abortus infection, with enhanced production of pro-inflammatory cytokines and predominantly T helper 1 responses . Including NdvA in such formulations could potentially enhance protective efficacy by targeting a critical virulence factor.

What diagnostic applications can be developed using recombinant NdvA?

Recombinant NdvA offers several potential diagnostic applications for brucellosis detection:

  • Serological assays:

    • ELISA-based detection of NdvA-specific antibodies in infected animals

    • Lateral flow immunoassays for rapid field diagnosis

    • Multiplex bead-based assays combining NdvA with other Brucella antigens

  • Molecular diagnostic approaches:

    • PCR primers targeting conserved regions of the ndvA gene

    • Development of isothermal amplification methods similar to the multiple cross displacement amplification (MCDA) techniques used for other Brucella targets

    • Combination with gold nanoparticles-based lateral flow biosensors for visual detection

The ultrasensitive and highly specific detection methods developed for Brucella could be adapted specifically for ndvA targets, potentially offering improved sensitivity and specificity in brucellosis diagnosis .

How can research on NdvA contribute to understanding Brucella epidemiology?

Studies of NdvA can provide valuable insights into Brucella epidemiology:

  • Genetic diversity analysis:

    • Sequencing of ndvA genes from diverse Brucella isolates

    • Identification of genetic variations that may affect protein function

    • Correlation with strain virulence and geographic distribution

  • Phylogenetic applications:

    • Using ndvA sequence data alongside whole-genome analyses for strain typing

    • Integration with established typing methods like MLST and MLVA

    • Development of molecular markers for epidemiological investigations

  • Host adaptation studies:

    • Comparison of ndvA sequences and expression patterns in different host-adapted Brucella species

    • Analysis of selection pressures on ndvA in different environmental conditions

Whole-genome sequencing approaches, as used in the study of B. abortus strains from Kazakhstan, could incorporate ndvA analysis to provide additional insights into strain relationships and transmission patterns .

What are the challenges in studying post-translational modifications of NdvA?

Investigating post-translational modifications (PTMs) of NdvA presents several technical challenges:

  • Identification challenges:

    • Low abundance of membrane proteins

    • Limitations in PTM-specific enrichment methods

    • Detergent interference with mass spectrometry analysis

    • Potential loss of labile modifications during sample preparation

  • Methodological approaches:

    • Targeted mass spectrometry with multiple reaction monitoring

    • Enrichment strategies for specific PTMs (phosphopeptides, glycopeptides)

    • Site-directed mutagenesis of potential modification sites

    • Generation of modification-specific antibodies

  • Functional validation challenges:

    • Correlating identified PTMs with functional changes

    • Recreating native modification patterns in recombinant systems

    • Temporal dynamics of modifications during infection

Understanding NdvA PTMs could reveal important regulatory mechanisms controlling beta-(1-->2)glucan export during different phases of the Brucella life cycle.

How does environmental sensing impact NdvA expression and function?

The regulation of NdvA in response to environmental conditions involves complex mechanisms:

  • Transcriptional regulation:

    • Influence of pH, temperature, and osmolarity on ndvA expression

    • Nutrient availability-dependent regulatory networks

    • Host environment-responsive transcription factors

  • Post-transcriptional control:

    • Small RNA-mediated regulation

    • mRNA stability under different stress conditions

    • Translational efficiency regulation

  • Functional modulation:

    • Allosteric regulation of transport activity

    • Protein-protein interactions modulating NdvA function

    • Membrane lipid composition effects on transporter activity

Experimental approaches to study these regulatory mechanisms include:

  • Reporter gene fusions to monitor promoter activity

  • RNA-seq analysis under varying environmental conditions

  • Protein activity assays in membrane environments mimicking different host conditions

What controversies exist regarding NdvA's precise role in Brucella virulence?

Several areas of active debate exist regarding NdvA's role in virulence:

Addressing these controversies requires comprehensive approaches combining genetics, biochemistry, structural biology, and in vivo infection models to fully elucidate NdvA's precise contribution to Brucella virulence.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.