Recombinant Brucella abortus biovar 1 Aquaporin Z (aqpZ)

Shipped with Ice Packs
In Stock

Description

Osmoregulatory Role

  • AqpZ mediates rapid bidirectional water transport across bacterial membranes, critical for surviving osmotic stress .

  • Expression of aqpZ is upregulated during hyperosmolar conditions and mid-exponential growth phases .

  • Knockout mutants show reduced viability in hypo-osmolar environments but no growth defects in hyperosmolar conditions .

Immunological Applications

While not directly tested as a vaccine component, Aquaporin Z is part of broader studies on Brucella subunit vaccines. Related findings include:

  • Combined Subunit Vaccines (CSVs): Recombinant Brucella outer membrane proteins (OMPs) like OMP22, OMP25, and ribosomal protein L7/L12 induce Th1 immune responses and reduce bacterial load in murine models .

  • Adjuvant Potential: Membrane proteins like AqpZ may enhance antigen presentation due to their localization and stability, though this requires validation .

Expression and Regulation

ConditionEffect on aqpZ ExpressionSource
Hyperosmolar StressUpregulated (2.5-fold increase in mRNA levels)
Mid-Exponential Growth PhasePeak expression
Hypo-Osmolar StressNo significant induction

Knockout Mutant Phenotypes

ParameterWild-Type vs. ΔaqpZ Mutant
Growth Rate in Rich MediaNo difference
Survival in Hypo-OsmolarityMutant viability drops by 60% after 50 hours
Osmotic Shock ResponseDelayed water flux recovery in mutants

Future Directions

  • Vaccine Development: AqpZ could be evaluated in combination with other OMPs to enhance immunogenicity .

  • Antimicrobial Targets: Targeting aquaporins may disrupt bacterial osmoregulation, offering new therapeutic strategies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for the estimated delivery time.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize developing the specified tag.
Synonyms
aqpZ; aqpX; BruAb1_1976; Aquaporin Z; Aquaporin X
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
Target Protein Sequence
MLNKLSAEFFGTFWLVFGGCGSAILAAAFPELGIGFLGVALAFGLTVLTMAYAVGGISGGHFNPAVSLGLTVAGRLPAKDLIPYWVAQVLGAIAAAAILYVIASGKDGFSAGGLASNGYGELSPGGYSMMAGLLIEIILTAFFIIIILGSTSSLAPAGFAPIAIGFGLTLIHLVSIPVTNTSVNPARSTGVALFADRAALSQLWLFWVAPLVGAVIGAIIWKGLLGRD
Uniprot No.

Target Background

Function
This protein facilitates the transport of water across cell membranes. It might play a role in adapting to variations in the pH or osmolarity within vacuoles.
Database Links
Protein Families
MIP/aquaporin (TC 1.A.8) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Aquaporin Z (aqpZ) in Brucella abortus and why is it significant?

Aquaporin Z (aqpZ, also referred to as aqpX in some literature) is a water channel protein found in the pathogenic bacterium Brucella abortus. It mediates rapid and large water fluxes in both directions in response to sudden osmotic up- or downshifts. The significance of aqpZ lies in its role in helping B. abortus adapt to changing osmotic environments, which is critical for bacterial survival during infection and environmental transitions . Studies have shown that expression of aqpZ is regulated during the growth curve and specifically induced under hyperosmolar conditions, making it the first reported example of a bacterial aquaporin induced in hypertonic conditions .

How is aqpZ expression regulated in Brucella abortus?

The expression of aqpZ in B. abortus is regulated both by growth phase and osmotic conditions. β-Galactosidase assays and RT-PCR analyses have demonstrated that:

  • AqpZ gene expression is markedly increased in hyperosmolar conditions

  • The amount of aqpZ mRNA is elevated in hypertonic environments

  • Expression levels are enhanced during the mid-exponential phase of bacterial growth

This dual regulation (growth phase and osmotic pressure) suggests that B. abortus actively modulates aqpZ expression to optimize water transport based on environmental conditions and metabolic requirements .

What methods are used to differentiate Brucella abortus biovar 1 from other biovars?

B. abortus biovar 1 can be differentiated from other biovars using PCR assays that exploit polymorphisms arising from species-specific localization of the genetic element IS711 in the Brucella chromosome. The AMOS PCR assay (named for Abortus-Melitensis-Ovis-Suis) utilizes five oligonucleotide primers that can identify B. abortus biovars 1, 2, and 4, with biovar 1 generating a specific 498 bp amplification product . The assay's specificity is determined by the size of the products amplified from primers hybridizing at various distances from the IS711 element, which has a distinctive distribution pattern across Brucella species and biovars . This technique has shown high effectiveness with U.S. field isolates of B. abortus .

How can I create an aqpZ null mutant of B. abortus for functional studies?

Creating an aqpZ null mutant for functional studies can be accomplished using gene fusion techniques. The established methodology involves:

  • Construct an aqpZ::lacZ gene fusion to disrupt the aqpZ gene while allowing monitoring of gene expression

  • Verify the null mutation through PCR and sequence analysis

  • Confirm protein absence using western blot analysis

  • Compare growth characteristics of the mutant strain with wild-type in both rich and minimal media to establish baseline phenotypes

  • Test the mutant under various osmotic conditions (hypo- and hyperosmolar) to assess functional effects

Research has demonstrated that such null mutants show no significant difference in growth rate compared to wild-type strains when grown in standard rich and minimal media, confirming that disruption of the aqpZ gene is not lethal for B. abortus .

What expression systems are most effective for producing recombinant B. abortus aqpZ protein?

Based on research practices with B. abortus proteins, effective expression systems for recombinant aqpZ include:

  • E. coli-based expression systems: Using vectors such as pCold-TF, which has been successfully employed for other B. abortus recombinant proteins. The trigger factor component in this vector may enhance protein solubility and proper folding .

  • Purification methodology:

    • Initial separation by affinity chromatography (His-tag or other fusion tags)

    • Further purification using size exclusion chromatography

    • Verification of purity by SDS-PAGE and Western blotting

    • Confirmation of functionality through water transport assays (typically using proteoliposomes or oocyte swelling tests)

When designing expression constructs, consider codon optimization for the host system and include appropriate purification tags that won't interfere with protein function or structure.

What is the relationship between bacterial AqpZ and human Aquaporin 4, and what are its implications for autoimmune disorders?

Research has provided direct evidence for structural homology and cross-immunoreactivity between bacterial AqpZ and human Aquaporin 4 (Aqp4) proteins. This cross-reactivity has significant implications for understanding the pathogenesis of Neuromyelitis Optica (NMO), an autoimmune disorder characterized by antibodies against human Aqp4 .

Key findings include:

  • Infection-induced cross-immunoreactivity may play a role in triggering anti-Aqp4 autoimmune responses in NMO

  • Anti-AqpZ antibodies can recognize epitopes on human Aqp4

  • Intracerebral injection of anti-AqpZ antibodies can affect motor function in experimental animals

This molecular mimicry suggests that Brucella infections or immunization with bacterial AqpZ could potentially trigger autoimmune responses against human Aqp4, providing a possible mechanistic link between infection and autoimmunity .

How does aqpZ contribute to the osmoadaptive mechanisms of B. abortus during infection?

The role of aqpZ in B. abortus osmoadaptation during infection involves multiple mechanisms:

  • Differential viability under osmotic stress: While aqpZ null mutants show normal growth in hyperosmolar environments, they demonstrate reduced viability in hypo-osmolar conditions after extended growth (50+ hours), suggesting a critical role in hypotonic adaptation .

  • Temporal expression patterns: B. abortus aqpZ expression is enhanced during the mid-exponential growth phase, indicating a potential role during active bacterial replication within host cells .

  • Osmotic regulation: The marked increase in aqpZ expression under hyperosmolar conditions suggests a protective role during transitions between different host environments or compartments with varying tonicity .

These findings indicate that aqpZ contributes to bacterial resilience during infection by facilitating adaptation to changing osmotic conditions encountered within different host cell compartments and extracellular environments.

What are the technical challenges in resolving the crystal structure of B. abortus aqpZ and how can they be overcome?

Resolving the crystal structure of membrane proteins like B. abortus aqpZ presents several technical challenges:

  • Protein expression and purification issues:

    • Low expression yields of functional protein

    • Potential toxicity to expression hosts

    • Maintaining protein stability during solubilization

  • Crystallization barriers:

    • Identifying optimal detergents for solubilization without compromising structure

    • Finding appropriate crystallization conditions

    • Obtaining crystals that diffract to high resolution

  • Solutions to overcome these challenges:

    • Use specialized expression systems with inducible promoters and fusion partners to improve yield and reduce toxicity

    • Implement lipidic cubic phase or bicelle-based crystallization methods specifically designed for membrane proteins

    • Consider protein engineering approaches to increase stability, such as creating truncations or introducing mutations that enhance crystallizability

    • Utilize nanobodies or crystallization chaperones to stabilize flexible regions

The successful crystallization of other bacterial aquaporins provides templates for experimental approaches, but the unique properties of B. abortus aqpZ may require customized optimization of these methods.

How can recombinant B. abortus aqpZ be utilized in vaccine development strategies?

Recombinant B. abortus aqpZ has potential applications in vaccine development based on findings with other B. abortus recombinant proteins:

  • Subunit vaccine component: AqpZ could be used alone or in combination with other immunogenic B. abortus proteins (like Omp16, Omp19, Omp28, and L7/L12) as part of a combined subunit vaccine (CSV) .

  • Adjuvant considerations:

    • Selection of appropriate adjuvants to enhance Th1-type immunity

    • Potential adjuvant combinations that promote balanced cell-mediated and humoral responses

  • Potential advantages over live attenuated vaccines:

    • Elimination of risks associated with reversion to virulence

    • Prevention of abortion in pregnant animals

    • Reduced risk of human infection during vaccine handling

While current research has focused on other B. abortus recombinant proteins, the unique properties of aqpZ, including its role in osmoadaptation and potential conservation across Brucella species, make it a candidate for inclusion in next-generation brucellosis vaccines.

What immunological assays are most effective for evaluating immune responses to recombinant B. abortus aqpZ?

Based on research with Brucella recombinant proteins, the following immunological assays are most effective for evaluating immune responses to recombinant B. abortus aqpZ:

  • Cellular immunity assessment:

    • Cytokine profiling (IFN-γ, IL-12, TNF-α, IL-6, IL-10) using ELISA or multiplex assays

    • Flow cytometry for T-cell subset characterization (CD4+, CD8+)

    • Nitric oxide production assay to assess macrophage activation

  • Humoral immunity evaluation:

    • Antibody isotype analysis (IgG1, IgG2a) by ELISA to determine Th1 vs Th2 bias

    • Immunoblotting assays with Brucella-positive and negative sera

    • Avidity assays to assess antibody maturation

  • Protection assessment:

    • In vitro infection models using macrophage cell lines (RAW 264.7)

    • In vivo challenge studies in appropriate animal models

The relative prominence of IgG2a over IgG1 and higher levels of IFN-γ compared to IL-10 would suggest a predominantly Th1 response, which is considered protective against intracellular pathogens like Brucella .

What promoter elements regulate aqpZ expression in B. abortus and how do they respond to osmotic stress?

While the specific promoter elements regulating aqpZ expression in B. abortus are not fully characterized in the provided search results, research with aqpZ null mutants using an aqpZ::lacZ gene fusion has revealed important aspects of its regulation:

  • Growth phase-dependent regulation: Expression levels are enhanced during the mid-exponential phase of growth, suggesting the presence of growth phase-responsive promoter elements .

  • Osmotic stress response elements: The marked increase in aqpZ gene expression and mRNA levels under hyperosmolar conditions indicates the presence of osmosensitive regulatory elements in the promoter region .

  • Potential regulatory mechanisms:

    • Two-component signaling systems that sense osmotic changes

    • Osmotic stress-responsive transcription factors

    • Alternative sigma factors that direct RNA polymerase to osmotic stress-responsive genes

Further research using techniques such as promoter deletion analysis, DNase I footprinting, and chromatin immunoprecipitation would be needed to precisely map the regulatory elements and identify the transcription factors involved in osmotic regulation of aqpZ expression.

How does the genetic context of the aqpZ gene in B. abortus biovar 1 differ from other Brucella species and biovars?

The genetic context of aqpZ in Brucella species shows important variations that can be exploited for species and biovar differentiation:

  • IS711 element distribution: The pattern of IS711 distribution (an 842 bp mobile genetic element also known as IS6501) is relatively unique and stable across Brucella species and biovars. B. abortus contains approximately 7 copies of IS711, whereas B. ovis and B. pinnipedialis contain more than 30 copies .

  • Biovar-specific genetic markers: PCR assays based on these polymorphisms can specifically identify B. abortus biovar 1 (along with biovars 2 and 4) through amplification of a characteristic 498 bp fragment, distinguishing it from other Brucella species and biovars .

  • Genomic insertions and deletions: Another source of Brucella genomic diversity involves insertions and deletions of nucleotide sequences ('indels') in various genes, ranging from a dozen to thousands of nucleotides. These polymorphisms contribute to the genetic context differences between various biovars of B. abortus .

The specific genetic neighborhood of the aqpZ gene may provide additional insights into its regulation and functional adaptation within different Brucella species and biovars.

How does B. abortus aqpZ function compare to aquaporins from other bacterial pathogens?

A comparative analysis of B. abortus aqpZ with aquaporins from other bacterial pathogens would examine:

  • Functional characteristics:

    • Water permeability rates and selectivity

    • Responsiveness to osmotic shifts

    • Potential transport of molecules beyond water (glycerol, urea, etc.)

  • Expression patterns:

    • While B. abortus aqpZ is induced in hyperosmolar conditions , aquaporins in other bacterial pathogens may show different expression patterns based on their ecological niches and pathogenic strategies

  • Structural features:

    • Conservation of the NPA (Asparagine-Proline-Alanine) motifs critical for water selectivity

    • Differences in channel diameter and selectivity filter regions

    • Variations in cytoplasmic and periplasmic loops that may influence regulation

  • Physiological roles:

    • Unlike some aquaporins that may be dispensable under standard growth conditions, B. abortus aqpZ appears important for long-term survival in hypo-osmolar environments , suggesting specialized adaptation to host environments

A comprehensive comparative analysis would require experimental determination of transport properties and detailed structural studies of B. abortus aqpZ alongside aquaporins from other pathogens.

What are the implications of cross-immunoreactivity between bacterial aqpZ and human Aquaporin 4 for drug discovery and therapeutic development?

The cross-immunoreactivity between bacterial AqpZ and human Aquaporin 4 (Aqp4) has significant implications for drug discovery and therapeutic development:

  • Potential off-target effects:

    • Drugs targeting bacterial AqpZ may potentially cross-react with human Aqp4

    • This presents both safety concerns and opportunities for repurposing

  • Autoimmunity considerations:

    • The structural homology between bacterial AqpZ and human Aqp4 may trigger autoimmune responses when targeting bacterial aquaporins

    • This relationship needs careful consideration when developing vaccines containing AqpZ components

  • Therapeutic targets:

    • Understanding the structural basis for cross-reactivity could help design drugs that selectively target bacterial AqpZ without affecting human Aqp4

    • Structure-based computational approaches could identify unique epitopes for targeted therapeutics

  • Diagnostic applications:

    • The cross-reactivity could be exploited to develop diagnostic tests for both Brucella infection and autoimmune conditions involving Aqp4 antibodies

    • Differential binding assays could distinguish pathogen-induced from autoimmune responses

This molecular mimicry phenomenon represents both a challenge and an opportunity in developing new therapeutic strategies against Brucella infections while minimizing autoimmune complications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.