Recombinant Brucella abortus biovar 1 ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Description

Introduction to ATP Synthase and the atpB Subunit

ATP synthase is a critical enzyme for bacterial energy production, catalyzing the conversion of ADP to ATP through proton motive force. In Brucella species, this enzyme is essential for survival, particularly during intracellular replication in host cells . The atpB gene encodes subunit a of ATP synthase, a transmembrane protein that facilitates proton translocation during ATP synthesis. While Brucella suis biovar 1 is the primary source of recombinant atpB studied in literature, its structural and functional homology to Brucella abortus biovar 1 is significant due to conserved genetic architecture across Brucella species .

Recombinant Protein Production and Characterization

The recombinant Brucella suis biovar 1 ATP synthase subunit a (atpB) is produced via heterologous expression in Escherichia coli. Key features include:

ParameterDetails
Protein LengthFull-length (1–249 amino acids)
Expression SystemE. coli (DH5α strain)
TagN-terminal His-tag for purification
FormLyophilized powder (for storage and reconstitution)
Molecular Weight~28 kDa (estimated based on sequence length and His-tag addition)
FunctionProton translocation during ATP synthesis

This protein is critical for studying ATP synthase’s role in Brucella’s energy metabolism and pathogenesis. Notably, ATP synthase activity is linked to Brucella’s ability to maintain intra-vacuolar survival by modulating host cell pH and nutrient acquisition .

Role in Brucella Physiology

ATP synthase subunit a contributes to:

  • Proton Motive Force (PMF): Drives ATP production in low-energy environments, such as host cell vacuoles .

  • Antigenic Potential: Subunit a is a candidate for subunit vaccines, though direct evidence in B. abortus remains limited.

  • Pathogenesis: Disruption of ATP synthase may impair Brucella’s ability to replicate intracellularly, as observed in other pathogens .

Vaccine Development Context

While atpB itself is not a primary target in B. abortus vaccine research, ATP synthase is implicated in broader strategies:

  • Live-Attenuated Vaccines: Mutations in ATP-binding cassette transporters (e.g., exsA) reduce virulence, suggesting energy metabolism as a vulnerability .

  • Subunit Vaccines: Recombinant proteins like Omp16, Omp19, and L7/L12 are prioritized, but ATP synthase subunits may offer complementary targets .

Table 2: ATP Synthase Function in Brucella

FunctionMechanism
Proton TranslocationSubunit a forms a channel for H⁺ movement across the membrane .
ATP SynthesisPMF generated drives ADP phosphorylation to ATP.
Host InteractionModulates vacuolar pH to favor bacterial replication .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will accommodate your request.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
atpB; BruAb1_0407; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
atpB
Target Protein Sequence
MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFAL SLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH
Uniprot No.

Target Background

Function
This protein is a key component of the proton channel. It plays a direct role in the translocation of protons across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the functional role of ATP synthase subunit a (atpB) in Brucella abortus?

ATP synthase in Brucella abortus, like in other bacteria, is crucial for energy metabolism through oxidative phosphorylation. The enzyme consists of two main subcomplexes: the membrane-embedded F0 and the catalytic F1. The subunit a (atpB) is a critical component of the F0 subcomplex and forms part of the membrane-integral proton channel that facilitates proton translocation across the membrane . This proton movement drives the rotary mechanism that powers ATP synthesis in the F1 subcomplex. In Brucella, energy production is particularly important during intracellular replication phases when the bacterium needs to adapt to nutrient-limited environments within host cells . The atpB subunit assists in maintaining the proton gradient necessary for ATP synthesis, which is essential for bacterial survival and virulence.

How can researchers effectively express and purify recombinant Brucella atpB protein?

For successful expression and purification of recombinant Brucella atpB, researchers should consider the following methodological approach:

  • Vector selection: Choose expression vectors with strong promoters (T7, tac) compatible with E. coli expression systems.

  • Optimization of codon usage: Synthesize the atpB gene with codon optimization for the expression host to enhance protein yield.

  • Expression conditions: Test multiple conditions including:

    • IPTG concentration (0.1-1.0 mM)

    • Expression temperature (16°C, 25°C, 37°C)

    • Expression duration (4-24 hours)

  • Solubility enhancement: Add solubility tags (MBP, SUMO, TrxA) or express as inclusion bodies with subsequent refolding.

  • Purification strategy: Implement a multi-step purification process:

    • Initial capture with affinity chromatography (IMAC if His-tagged)

    • Intermediate purification using ion-exchange chromatography

    • Polishing step with size-exclusion chromatography

For membrane proteins like atpB, detergent screening (DDM, LDAO, C12E8) is critical for maintaining protein stability during purification . Recent protocols achieving >90% purity have employed a combination of Ni-NTA chromatography followed by gel filtration.

What expression patterns does atpB show during different growth phases of Brucella abortus?

ATP synthase subunit a exhibits differential expression patterns during Brucella's growth cycle, reflecting the changing energy demands of the bacterium. Based on proteomic analyses:

Growth PhaseRelative atpB ExpressionEnergy Metabolism Status
Early ExponentialModerateEstablishing energy production systems
Mid-ExponentialHighMaximum energy production for rapid growth
Late ExponentialHighSustained energy requirements
Early StationaryDecliningAdjustment to nutrient limitation
Late StationaryLowEnergy conservation mode

Proteomic analysis of Brucella abortus reveals that ATP synthase components, including atpB, are significantly downregulated during the transition from exponential to stationary phase . This regulation likely represents an adaptation to decreased energy requirements as the bacteria shift from active replication to a persistence state. The pattern suggests that atpB expression is tightly regulated in response to environmental conditions, with expression levels directly correlating with the bacterium's energy needs.

How does atpB contribute to Brucella's adaptation to intracellular environments?

The ATP synthase subunit a plays a crucial role in Brucella's adaptation to the challenging intracellular niche within host macrophages. When Brucella enters host cells, it encounters a nutrient-limited environment that requires metabolic adjustments. Proteomic studies comparing exponential and stationary phase Brucella indicate that energy production mechanisms undergo significant regulation during adaptation to stress conditions .

AtpB contributes to this adaptation through several mechanisms:

  • pH Tolerance: The proton channel formed partly by atpB helps maintain internal pH homeostasis when Brucella encounters acidified phagosomes.

  • Energy Conservation: Modulation of ATP synthase activity allows Brucella to adjust energy production according to available resources.

  • Stress Response Integration: AtpB expression appears coordinated with stress response systems, including those activated during the Unfolded Protein Response (UPR) .

Research using label-free proteomics reveals that Brucella adjusts its energy production mechanisms differently between exponential and stationary growth phases when facing starvation conditions . This suggests that the regulation of ATP synthase components, including atpB, is part of a sophisticated adaptation strategy that enables Brucella to persist in hostile host environments.

What is the relationship between atpB function and the Brucella Type IV Secretion System (T4SS)?

The relationship between ATP synthase subunit a and the T4SS represents an intriguing area of Brucella pathogenesis research. While direct protein-protein interactions remain incompletely characterized, several functional relationships have been observed:

  • Energy Requirement: The T4SS is an energy-dependent secretion apparatus that requires ATP, linking it functionally to ATP synthase activity.

  • Coordinated Expression: Proteomic analyses indicate that both ATP synthase components and T4SS proteins show regulation patterns that suggest coordination during infection .

  • Virulence Contribution: Both systems are crucial for Brucella's intracellular lifestyle, with the T4SS being essential for establishing chronic infection .

The T4SS encoded by the virB operon (virB1-12) is crucial for Brucella's ability to establish persistent infection . This system secretes effector proteins that modulate host cell functions, including manipulation of intracellular trafficking to establish the replicative niche. ATP production mediated by functional ATP synthase, including the atpB subunit, likely provides the energy required for T4SS assembly and function.

Researchers investigating the interplay between these systems should consider dual knockdown experiments to assess functional dependencies and co-immunoprecipitation studies to identify potential physical interactions.

What methodologies are most effective for studying atpB mutations and their impact on Brucella virulence?

To effectively study atpB mutations and their impact on virulence, researchers should employ a multi-layered methodological approach:

  • Genetic Manipulation Strategies:

    • Site-directed mutagenesis targeting conserved residues in the proton channel

    • Construction of conditional knockdown strains using tetracycline-inducible systems

    • CRISPR-Cas9 genome editing for precise modifications

  • Functional Assessment Methods:

    • ATP synthesis assays using inverted membrane vesicles

    • Membrane potential measurements with fluorescent probes

    • Growth curve analysis under various stress conditions

    • pH homeostasis evaluation using intracellular pH indicators

  • Virulence Characterization:

    • Macrophage infection assays measuring intracellular survival

    • Trafficking studies using fluorescence microscopy

    • Animal infection models with competitive index determinations

    • Transcriptomics to identify compensatory mechanisms

  • Structural Biology Approaches:

    • Cryo-EM analysis of ATP synthase complexes

    • Molecular dynamics simulations to predict mutation effects

    • Protein-protein interaction studies using bacterial two-hybrid systems

When interpreting results, researchers should be aware that complete atpB deletion may be lethal, necessitating conditional or partial loss-of-function approaches. Additionally, compensatory mutations may arise during experimentation, requiring careful genetic verification throughout the study.

How does the Unfolded Protein Response (UPR) in host cells interact with Brucella ATP synthase function?

The relationship between host UPR and Brucella ATP synthase represents a fascinating intersection of host-pathogen interactions. Research indicates that Brucella induces a UPR in infected host cells, which appears to benefit bacterial replication . This interaction with ATP synthase may occur through several mechanisms:

  • Energy Requirements During UPR: The UPR-induced restructuring of the endoplasmic reticulum (ER) creates a metabolically active environment where Brucella replicates. Functional ATP synthase provides the energy needed for bacterial processes during this critical phase.

  • ER Stress Response Modulation: Brucella proteins, including the microtubule-modulating protein TcpB, induce UPR and dramatic restructuring of the ER . This environment may affect ATP synthase function through alterations in membrane potential or pH gradients.

  • Temporal Coordination: Expression analysis shows that UPR induction coincides with intracellular replication phases when ATP synthase components are highly expressed.

Experimental evidence demonstrates that pharmacological inhibition of the UPR with tauroursodeoxycholic acid significantly impairs Brucella replication in macrophages . This suggests that the intracellular conditions created by the UPR may optimize ATP synthase function, enhancing energy production during the replicative phase.

Research methodologies to investigate this relationship should include:

  • Simultaneous monitoring of UPR markers and bacterial ATP synthase activity

  • Targeted inhibition of specific UPR branches to assess effects on bacterial energy metabolism

  • Microscopy techniques to visualize ATP synthase localization during ER remodeling

What potential does atpB hold as a target for novel anti-Brucella therapeutics?

ATP synthase subunit a represents a promising therapeutic target due to its essential role in bacterial energy metabolism and its structural differences from mammalian homologs. Several factors make atpB particularly attractive for drug development:

  • Essential Function: ATP synthesis is critical for Brucella survival, especially during intracellular replication.

  • Surface Accessibility: As a membrane-embedded protein, certain domains of atpB may be accessible to inhibitors.

  • Structural Uniqueness: Bacterial F-type ATP synthases differ sufficiently from mammalian equivalents to allow selective targeting.

  • Precedent in Other Pathogens: ATP synthase inhibitors such as bedaquiline have proven effective against Mycobacterium tuberculosis, suggesting similar approaches may work for Brucella.

Potential therapeutic approaches include:

ApproachMechanismDevelopment StageChallenges
Small molecule inhibitorsBinding to proton channelPreclinical screeningMembrane penetration
Peptide inhibitorsDisruption of subunit interactionsEarly developmentStability and delivery
Structure-based designTargeting unique bacterial regionsVirtual screening phaseStructural validation required
Combination therapyATP synthase + virulence inhibitorsConcept stageDrug-drug interactions

The development pipeline should incorporate assays for inhibitor specificity, confirming minimal impact on mammalian ATP synthases. Researchers should also consider that Brucella's intracellular lifestyle necessitates that potential therapeutics penetrate host cell membranes to reach their target.

What are the optimal conditions for heterologous expression of Brucella abortus atpB?

Successful heterologous expression of Brucella atpB requires careful optimization of multiple parameters to overcome the challenges associated with membrane protein expression. Based on collective research findings:

ParameterOptimal ConditionsRationale
Expression HostC41(DE3) or C43(DE3) E. coliEngineered for membrane protein tolerance
VectorpET series with T7 promoterControllable, strong expression
Induction Temperature18-22°CReduces inclusion body formation
IPTG Concentration0.1-0.3 mMModerate induction prevents toxicity
Culture MediumTB or 2xYT with glycerolEnhanced biomass and membrane formation
Induction TimingOD600 = 0.6-0.8Balance between cell density and metabolic state
Expression Duration16-20 hoursExtended time for proper folding
Additives1% glucose pre-inductionReduces leaky expression
5% ethanolStress response enhances membrane protein integration

For membrane extraction and protein purification, researchers should implement:

  • Gentle cell lysis using EDTA-lysozyme treatment followed by sonication

  • Membrane solubilization with n-dodecyl β-D-maltoside (DDM) at 1-2% concentration

  • Two-step purification combining affinity chromatography and size exclusion

When assessing expression success, western blotting against the His-tag and ATP synthase activity assays should be employed as complementary verification methods .

How can researchers effectively analyze the contribution of atpB to Brucella pathogenesis in vivo?

To effectively analyze atpB's contribution to Brucella pathogenesis in vivo, researchers should implement a multi-faceted experimental approach:

  • Generation of Experimental Strains:

    • Conditional atpB mutants using inducible promoters

    • Point mutations targeting key functional residues

    • Complemented strains for verification of phenotype restoration

    • Reporter fusions to monitor atpB expression in vivo

  • In Vivo Infection Model Selection:

    • Mouse model (BALB/c) for systemic infection assessment

    • Pregnant ruminant models for reproductive pathology

    • Cell-specific infection tracking using fluorescent Brucella

  • Analytical Techniques:

    • Competitive index assays comparing mutant vs. wild-type

    • In vivo imaging systems (IVIS) for real-time infection tracking

    • Immunohistochemistry to identify tissue localization

    • Tissue-specific bacterial load quantification

    • Host immune response profiling (cytokines, cellular recruitment)

  • Experimental Design Considerations:

    • Appropriate controls (including complementation)

    • Sufficient biological replicates (n≥8 per group)

    • Time-course sampling (early, middle, late infection phases)

    • Multiple tissue analysis (spleen, liver, lymph nodes, reproductive organs)

When interpreting results, researchers should consider that atpB function may have different impacts during distinct phases of infection. Early colonization, intracellular replication, and persistent infection may each be affected differently by atpB mutations . Additionally, compensatory mechanisms may obscure the full impact of atpB disruption, necessitating careful secondary validation experiments.

What experimental approaches can resolve contradictions in atpB expression data between in vitro and in vivo conditions?

Resolving contradictions between in vitro and in vivo atpB expression data requires specialized experimental approaches that bridge these distinct environments:

  • Ex Vivo Transition Studies:

    • Culture bacteria in broth, then immediately transition to macrophage infection

    • Sample at multiple timepoints (0, 1, 4, 8, 24, 48 hours)

    • Perform parallel RNA-seq and proteomics to track transcriptional and translational regulation

  • Environment-Mimicking Culturing:

    • Develop media formulations that mimic intracellular ion concentrations

    • Adjust pH, nutrient availability, and oxygen tension to match intracellular conditions

    • Compare atpB expression in standard versus mimetic media

  • Direct In Vivo Sampling:

    • Implement bacterial recovery methods that preserve the expression state

    • Use rapid RNA stabilization during bacterial isolation from tissues

    • Apply single-cell techniques to avoid population averaging effects

  • Reporter Systems:

    • Construct dual reporters (transcriptional and translational fusions)

    • Include destabilized reporter proteins to capture dynamic regulation

    • Validate with complementary techniques (RT-qPCR, western blotting)

  • Data Integration Approach:

    • Apply statistical methods designed for cross-platform data integration

    • Develop normalization strategies to compare across experimental systems

    • Use machine learning algorithms to identify environmental variables that best predict expression patterns

When analyzing results, researchers should consider that expression differences may reflect genuine biological adaptations rather than technical artifacts. The ATP synthase complex components, including atpB, show differential regulation in response to nutrient starvation in different growth phases , suggesting complex regulatory mechanisms that respond to environmental conditions.

How can structural studies of Brucella ATP synthase inform vaccine development efforts?

Structural studies of Brucella ATP synthase can significantly advance vaccine development through several mechanisms:

  • Epitope Identification and Engineering:
    Detailed structural characterization of atpB can reveal surface-exposed epitopes that are:

    • Accessible to antibodies

    • Conserved across Brucella species and biovars

    • Structurally stable and less prone to mutation

  • Rational Antigen Design:
    Structural information enables:

    • Creation of chimeric antigens combining multiple protective epitopes

    • Stabilization of conformational epitopes through strategic mutations

    • Development of structure-based peptide vaccines targeting critical functional regions

  • Adjuvant Development:

    • ATP synthase components can function as built-in adjuvants

    • Structural modifications can enhance immunogenicity without compromising stability

  • Delivery System Optimization:

    • Structural data inform optimal presentation in liposomes or nanoparticles

    • Enable calculations of surface charge and hydrophobicity for delivery vehicle design

Recent proteomic studies have identified ATP synthase components among the immunogenic proteins recognized by sera from brucellosis patients . The VirB proteins of the Type IV secretion system have shown promise as diagnostic antigens with sensitivity and specificity exceeding 0.91, suggesting similar potential for ATP synthase components .

For effective implementation, researchers should:

  • Combine cryo-EM and X-ray crystallography approaches for comprehensive structural characterization

  • Implement epitope mapping using sera from naturally infected hosts

  • Validate candidate epitopes through competitive binding assays

  • Confirm immunogenicity in appropriate animal models

What cutting-edge technologies are advancing our understanding of atpB structure-function relationships?

The structural and functional characterization of Brucella atpB is being revolutionized by several cutting-edge technologies:

  • Cryo-Electron Microscopy (Cryo-EM):

    • Enables visualization of the complete ATP synthase complex at near-atomic resolution

    • Captures different conformational states during the catalytic cycle

    • Reveals interactions between atpB and other subunits without crystallization

  • Molecular Dynamics Simulations:

    • Model proton movement through the atpB channel

    • Predict effects of mutations on protein stability and function

    • Simulate drug binding and identify potential inhibitor binding sites

  • Single-Molecule Techniques:

    • Fluorescence resonance energy transfer (FRET) to monitor conformational changes

    • Optical tweezers to measure force generation during ATP synthesis

    • Single-molecule tracking to observe ATP synthase dynamics in living bacteria

  • Advanced Genetic Tools:

    • CRISPR interference for precise transcriptional regulation

    • Unnatural amino acid incorporation for site-specific biophysical probes

    • Microfluidic-based high-throughput mutagenesis and phenotyping

  • Integrative Structural Biology:

    • Combining information from multiple techniques (X-ray, NMR, mass spectrometry)

    • Cross-linking mass spectrometry to map protein-protein interactions

    • Hydrogen-deuterium exchange mass spectrometry to identify dynamic regions

Recent research on bacterial ATP synthases has revealed critical insights into the proton translocation mechanism through subunit a, which contains two offset half-channels separated by a conserved arginine residue . Applying these technologies to Brucella atpB will likely reveal unique structural adaptations that contribute to the pathogen's resilience in the intracellular environment.

How does proteomics research enhance our understanding of atpB regulation during Brucella's life cycle?

Proteomics research has provided crucial insights into atpB regulation throughout the Brucella life cycle, revealing sophisticated adaptation mechanisms:

  • Growth Phase-Dependent Regulation:
    Label-free proteomics has demonstrated that ATP synthase components show differential expression between exponential and stationary growth phases . This suggests precise regulation of energy production machinery as Brucella transitions between active replication and persistence states.

  • Stress Response Integration:
    Proteomic analysis under starvation conditions reveals that Brucella in exponential phase significantly adjusts expression of energy-related proteins, while stationary phase bacteria show more limited protein expression changes . This indicates that:

    • ATP synthase regulation is integrated with broader stress response networks

    • Different growth phases employ distinct adaptive strategies

    • Energy metabolism adjustments are precisely calibrated to environmental conditions

  • Post-Translational Modifications:
    Advanced proteomics techniques such as Tandem Mass Tag (TMT) technology have identified post-translational modifications that affect ATP synthase function . These modifications may serve as rapid regulatory mechanisms that fine-tune energy production without requiring new protein synthesis.

  • Protein Complex Assembly Dynamics:
    Proteomics approaches focused on protein interactions have revealed insights into ATP synthase assembly pathways and potential regulatory interactions with other cellular components.

  • Comparative Proteomics Applications:

    • Between wild-type and virulence-attenuated strains

    • Across different host cell types during infection

    • Under various antibiotic treatments or stress conditions

For researchers interested in atpB regulation, the most informative proteomic approaches include:

  • Quantitative temporal profiling during infection cycles

  • Interaction proteomics to identify regulatory binding partners

  • Phosphoproteomics to map signaling pathways affecting ATP synthase

  • Comparative analysis between virulent and attenuated strains

How can knowledge of atpB function contribute to improved diagnostic methods for brucellosis?

Knowledge of ATP synthase subunit a can significantly enhance brucellosis diagnostic methods through several innovative approaches:

  • Recombinant Protein-Based Diagnostics:

    • Purified recombinant atpB can serve as a target antigen in ELISA-based diagnostics

    • Multiple ATP synthase components could be combined in multiplexed assays for increased sensitivity

    • Conformational epitopes unique to native ATP synthase structure may provide higher specificity

  • Peptide-Based Approaches:

    • Immunodominant epitopes from atpB can be synthesized as peptides for diagnostic use

    • Synthetic peptide arrays can identify patient-specific antibody responses

    • Conserved epitopes across Brucella species enable pan-Brucella detection

  • Nucleic Acid-Based Detection:

    • atpB sequence can serve as a target for PCR-based diagnostics

    • Species-specific polymorphisms in atpB can differentiate Brucella species and biovars

    • LAMP (Loop-mediated isothermal amplification) assays targeting atpB enable field diagnostics

Research using TMT-based proteomics has already demonstrated the diagnostic potential of Brucella proteins, with VirB system components showing sensitivity and specificity exceeding 0.91 in serological diagnosis . This suggests ATP synthase components may have similar potential.

For implementation, researchers should:

  • Evaluate cross-reactivity with other bacterial pathogens

  • Establish sensitivity using sera from early and chronic infection stages

  • Validate diagnostic performance across different host species

  • Compare performance against current gold-standard tests

The ideal diagnostic approach would likely combine multiple antigens, including ATP synthase components and established immunodominant proteins, to maximize both sensitivity and specificity.

What insights from atpB research could impact treatment strategies for persistent Brucella infections?

Research on ATP synthase subunit a provides several promising avenues for improving treatment of persistent Brucella infections:

  • Novel Therapeutic Targets:
    AtpB represents a potentially druggable target due to its:

    • Essential role in bacterial energy metabolism

    • Surface-exposed domains accessible to inhibitors

    • Structural differences from mammalian ATP synthases

  • Metabolic Vulnerability Exploitation:

    • Understanding how Brucella regulates ATP synthase during persistence reveals metabolic vulnerabilities

    • Stationary phase adaptation mechanisms show that energy conservation is critical for long-term survival

    • Forcing energy expenditure through metabolic interference could compromise bacterial persistence

  • Host-Directed Therapy Approaches:

    • The relationship between Brucella and host UPR suggests therapeutic possibilities

    • UPR modulators like tauroursodeoxycholic acid significantly impair Brucella replication

    • Combining UPR modulators with traditional antibiotics may enhance clearance of persistent bacteria

  • Treatment Timing Optimization:

    • ATP synthase expression patterns during different growth phases can inform optimal timing of antibiotic administration

    • Stationary phase bacteria show different protein regulation patterns in response to stress compared to exponential phase

    • Treatment protocols could be designed to target bacteria in both active and persistent states

  • Combination Therapy Design:

    • ATP synthase inhibitors could be combined with drugs targeting Type IV secretion system components

    • Targeting multiple essential systems simultaneously reduces the likelihood of resistance development

    • Therapeutic synergy may allow dose reduction of individual agents

Researchers investigating these approaches should implement:

  • In vitro persistence models that accurately mimic in vivo conditions

  • Animal models of chronic brucellosis for therapeutic validation

  • Pharmacokinetic/pharmacodynamic studies to ensure inhibitors reach intracellular bacteria

  • Resistance development monitoring for ATP synthase-targeted therapeutics

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.