Recombinant Brucella abortus biovar 1 Flagellar M-ring protein (fliF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If a particular tag type is required, please inform us, and we will prioritize its development.
Synonyms
fliF; BruAb2_1083; Flagellar M-ring protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-580
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
fliF
Target Protein Sequence
MAVVWMQQNFQQLIEQLKGTLGKLGARKLIALGLVGAALMGAILYTSIYLGRPSYETLYV GLSRDDVNRMGLALGEAGIPFDVKSDGSSILVPIGKAENARMYLAEKGLPTSNNAGYELF DNMGSLGLTSFMQEITRVRALEGEIARTIQAIRGVKAARVHIVLAEKGSFRRGDQKPSAS VVIRAEGGFSAESAQSIRQLVAAAVPSLDASSVTVLDTNGHLLASAGEGANGAALMTASL EQQVASHVDDSIRKALAPYLGLGHFQTSVQAALDTDRRQTKETTYDPESRVERSVRVVRE SGDSRNNRNDNATGVEQNIPQEQIQNRNGESSTEKMDRREELTNYEVNSKTVSTVSDGYS IKRLSIAVVIDQARLLQTAGTTPPPANFVDQQITKIRDLVATAAGLNTNRGDVINVTAVN FLDPAGADMEPVSAPWTDTLLRQSGSYANALAILAAVGLLIWFGLRPLLRDQNVKPAGTE VAIREAGEVATPNFIGGAESVGEGVQAVIGGPAAYADQMKTSLSDLRQRMRMPAKLRLEQ MIEMDEERVAAVLKQWIHETASGREADPAKASAMPELKAA
Uniprot No.

Target Background

Function

The M ring is believed to play an active role in energy transduction.

Database Links
Protein Families
FliF family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein. Bacterial flagellum basal body.

Q&A

What is the flagellar M-ring protein (FliF) in Brucella abortus and what is its function?

FliF is a structural protein that forms the MS-ring complex, which serves as the foundation for flagellar assembly in Brucella abortus. Although B. abortus was traditionally described as non-motile, genomic analysis has revealed that it possesses all the necessary flagellar genes for synthesis of a functional flagellum . FliF anchors the flagellar structure to the cytoplasmic membrane and provides a platform for the assembly of other flagellar components. The protein is crucial for flagellum formation and has been shown to be required for the intracellular survival of Brucella species, suggesting its importance beyond motility functions .

How does the flagellar system contribute to Brucella abortus virulence?

The flagellar system in B. abortus contributes to virulence through multiple mechanisms beyond motility. Studies have demonstrated that mutations in flagellar proteins, including FliF, result in reduced intracellular survival capacity within professional and non-professional phagocytic cells . The flagellar apparatus appears to be critical for bacterial adhesion to host cells, escape from the endocytic route, and establishing a replicative niche in the endoplasmic reticulum . Additionally, flagellar gene expression is regulated by quorum-sensing (QS) transcriptional regulators like VjbR, which also controls the type IV secretion system necessary for virulence .

What are the key genomic features of the fliF gene in Brucella abortus biovar 1?

The fliF gene in B. abortus is part of a flagellar gene cluster that is transcriptionally regulated by the VjbR quorum-sensing system. Unlike some other flagellar proteins like FlgJ (which is encoded outside the main flagellar gene cluster), FliF is typically located within the main flagellar genetic locus . The expression of fliF is under strict regulatory control, similar to other flagellar genes in Brucella, which are expressed under precise in vitro conditions and during specific stages of infection .

What expression systems are most effective for producing recombinant FliF from Brucella abortus?

For recombinant FliF production, E. coli-based expression systems using vectors with strong inducible promoters (such as T7) have proven effective. The methodology similar to that used for other Brucella flagellar proteins can be adapted, where the gene of interest is amplified from B. abortus genomic DNA using primers with appropriate restriction enzyme sites (e.g., NdeI and BamHI) . For optimal expression, codon optimization may be necessary when expressing Brucella proteins in E. coli due to codon usage differences. Expression conditions typically involve induction with IPTG at concentrations of 0.1-1.0 mM when cultures reach mid-log phase (OD600 of 0.5-0.8), followed by growth at lower temperatures (16-25°C) to enhance protein solubility.

What purification strategies yield the highest purity and activity for recombinant FliF?

A multi-step purification approach is most effective for recombinant FliF. Initial purification typically employs affinity chromatography using histidine tags and Ni-NTA resin, similar to methods used for other flagellar proteins in Brucella research . Following affinity purification, size exclusion chromatography helps remove aggregates and improve homogeneity. For structural studies or applications requiring extremely pure protein, ion exchange chromatography can be used as an additional purification step. Throughout purification, it's critical to maintain appropriate buffer conditions (typically pH 7.5-8.0 with 150-300 mM NaCl) and include protease inhibitors to prevent degradation. Purification yields and protein activity should be assessed through SDS-PAGE, Western blotting, and functional assays appropriate for membrane proteins.

How can researchers overcome challenges in expressing membrane-associated proteins like FliF?

Membrane proteins like FliF present unique challenges for recombinant expression. Several strategies can improve yields:

  • Use specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3))

  • Employ detergent solubilization during extraction (commonly with n-dodecyl β-D-maltoside or CHAPS)

  • Consider fusion partners that enhance solubility (MBP, SUMO, or Mistic)

  • Express truncated versions containing soluble domains for functional studies

  • Optimize induction conditions (lower IPTG concentrations, reduced temperatures)

  • Screen multiple buffer conditions during purification to maintain protein stability

When working with detergent-solubilized FliF, it's essential to carefully select detergent concentrations above the critical micelle concentration throughout purification to maintain protein stability and prevent aggregation.

What genetic manipulation strategies are most effective for studying FliF function in Brucella abortus?

For genetic manipulation of fliF in B. abortus, a non-polar, unmarked gene excision strategy similar to that described for zur gene mutation is most effective . This approach involves:

  • Amplifying approximately 1-kb fragments upstream and downstream of the fliF gene

  • Cloning these fragments into a suicide vector (e.g., pNTPS138)

  • Introducing the construct into B. abortus via electroporation

  • Selecting merodiploid transformants using antibiotic resistance

  • Counter-selection on sucrose-containing media to identify colonies that have undergone allelic exchange

For complementation studies, the wild-type fliF gene can be cloned into a broad-host-range vector like pVB1 and introduced into the mutant strain . The expression can be verified through RT-PCR or Western blot analysis. This genetic system allows for precise evaluation of FliF's contribution to virulence, flagellar assembly, and intracellular survival.

How can researchers effectively evaluate the contribution of FliF to Brucella virulence in cellular and animal models?

A comprehensive approach to evaluating FliF's contribution to virulence includes:

Cellular Models:

  • Macrophage infection assays (J774.A1, RAW264.7, or primary cells) to assess intracellular survival

  • HeLa or other non-professional phagocytic cell infection to evaluate invasion capacity

  • Confocal microscopy with markers for endoplasmic reticulum (ER) and endosomal compartments to track intracellular trafficking

  • Flow cytometry to quantify bacterial adhesion and invasion efficiency

Animal Models:

  • BALB/c mice infection with wild-type, ΔfliF mutant, and complemented strains

  • Collection of tissue samples (spleen, liver) at different time points post-infection (1, 2, 4, 8 weeks)

  • Determination of bacterial burdens through CFU counting

  • Histopathological analysis to assess tissue damage and inflammatory response

Comparative analysis between wild-type, mutant, and complemented strains provides robust evidence for FliF's specific contributions to virulence. Statistical analysis should include appropriate tests (ANOVA with post-hoc comparisons) to determine significant differences between strains .

What experimental approaches can determine if recombinant FliF retains its native structure and function?

Multiple complementary approaches can verify the structural and functional integrity of recombinant FliF:

How can researchers use recombinant FliF to develop diagnostic tools or vaccine candidates for brucellosis?

Recombinant FliF can be utilized for both diagnostic and vaccine development through several approaches:

Diagnostic Applications:

  • Development of ELISA-based serological tests using purified recombinant FliF to detect B. abortus-specific antibodies in infected hosts

  • Creation of lateral flow immunoassays for rapid field diagnostics

  • Multiplex protein arrays incorporating FliF along with other immunodominant Brucella antigens for improved sensitivity and specificity

Vaccine Development:

  • Subunit vaccine formulations using recombinant FliF, potentially combined with appropriate adjuvants

  • Prime-boost strategies incorporating FliF-encoding DNA vaccines followed by protein boosting

  • Design of attenuated live vaccine strains with modified FliF expression that maintains immunogenicity while reducing virulence

  • Construction of vectored vaccines expressing FliF epitopes

Preliminary studies with another flagellar protein (FlgJ) have shown that vaccination with recombinant flagellar proteins can confer significant protection against B. abortus infection in mice , suggesting similar approaches might be effective with FliF.

What insights can structural studies of FliF provide about flagellar assembly in Brucella abortus?

Structural studies of FliF can reveal critical insights into flagellar assembly mechanisms specific to Brucella:

  • High-resolution structures (obtained through X-ray crystallography or cryo-EM) can identify unique structural features distinguishing Brucella FliF from other bacterial species

  • Structural analysis can map interaction domains with other flagellar components (FlhA, FliG)

  • Comparative structural analysis between Brucella FliF and homologs from other pathogens can reveal evolutionary adaptations

  • Structure-guided mutagenesis can identify critical residues for flagellar assembly and function

These structural insights could explain how Brucella coordinates flagellar expression under specific environmental conditions and how the flagellum contributes to virulence despite limited motility function. Additionally, structural information might reveal potential sites for targeted inhibition that could form the basis for novel antimicrobial strategies.

How does zinc homeostasis impact flagellar gene expression and FliF function in Brucella abortus?

Metal homeostasis, particularly zinc, has significant implications for flagellar gene expression and function in Brucella:

  • Zinc is essential for B. abortus virulence, and zinc uptake systems are linked to pathogenesis

  • Transcriptional regulators like Zur (zinc uptake regulator) control expression of zinc homeostasis genes and potentially influence flagellar gene expression networks

  • Zinc limitation conditions (created using chelators like TPEN) can alter flagellar gene expression patterns

  • FliF and other flagellar proteins may contain zinc-binding domains critical for their structural integrity or function

Researchers should consider analyzing fliF expression under different zinc concentrations and in zur mutant backgrounds to understand these relationships. Additionally, metal binding assays can determine if FliF directly interacts with zinc, which would provide further insights into structure-function relationships. The integration of flagellar assembly with metal homeostasis represents an important area for understanding Brucella adaptation to host environments where metal limitation is a key defense mechanism.

What statistical approaches are most appropriate for analyzing virulence data from FliF mutant studies?

For robust statistical analysis of virulence data comparing wild-type, ΔfliF mutant, and complemented strains, researchers should employ:

  • For in vitro cellular infection data:

    • Two-way ANOVA with time and bacterial strain as factors, followed by appropriate post-hoc tests (Tukey's or Bonferroni)

    • Log-transformation of CFU data to achieve normal distribution when necessary

    • Minimum sample sizes of 3-5 independent biological replicates with technical triplicates

  • For animal model data:

    • Non-parametric tests (Mann-Whitney or Kruskal-Wallis) for bacterial burden comparisons

    • Survival curve analysis using Kaplan-Meier plots with log-rank tests

    • Power analysis to determine appropriate animal numbers (typically 5-10 mice per group)

    • Mixed-effects models for experiments with repeated measurements

  • For gene expression data:

    • Relative quantification using the 2^-ΔΔCT method for qRT-PCR

    • Appropriate housekeeping genes for normalization (rpoB or 16S rRNA for Brucella)

Researchers should clearly report P-values, confidence intervals, and effect sizes to fully characterize the impact of FliF on virulence parameters.

How can researchers troubleshoot common challenges in recombinant FliF expression and purification?

ChallengePossible CausesTroubleshooting Strategies
Low expression yieldToxicity to host cells, codon bias, protein instabilityTry lower induction temperatures (16-20°C), use codon-optimized sequence, test different E. coli strains (BL21, Rosetta, C41/C43), include stabilizing agents in media
Protein insolubilityMembrane protein nature, improper foldingUse mild detergents (DDM, CHAPS), add solubilizing tags (MBP, SUMO), express at lower temperatures, include chemical chaperones in growth media
Protein degradationProtease activity, intrinsic instabilityAdd protease inhibitors, reduce expression time, purify at 4°C, optimize buffer pH and salt concentration
Poor purity after affinity chromatographyNon-specific binding, incomplete washingIncrease imidazole in wash buffers, add low concentrations of detergents to wash buffers, try different affinity tags
Loss of activity after purificationDenaturation, cofactor lossInclude stabilizing agents (glycerol, specific metal ions), optimize buffer conditions, verify proper refolding

When encountering expression issues, a systematic approach testing multiple conditions in parallel (expression mini-screen) can efficiently identify optimal parameters for FliF production.

How can researchers distinguish between direct effects of FliF mutation and indirect effects on other cellular processes?

Distinguishing direct from indirect effects of FliF mutation requires a multi-faceted approach:

  • Transcriptomic analysis:

    • RNA-Seq comparing wild-type, ΔfliF mutant, and complemented strains

    • Identification of differentially expressed genes beyond the flagellar regulon

    • Pathway enrichment analysis to identify affected cellular processes

  • Proteomic analysis:

    • Comparative proteomics to identify changes in protein abundance

    • Phosphoproteomics to detect alterations in signaling pathways

    • Secretome analysis to identify changes in protein secretion

  • Phenotypic characterization:

    • Growth curves in different media to assess metabolic effects

    • Stress response assays (oxidative, pH, temperature)

    • Cell envelope integrity tests

    • Biofilm formation assessment

  • Genetic approaches:

    • Suppressor mutation screening to identify genes that can compensate for fliF mutation

    • Construction of double mutants to test genetic interactions

    • Conditional expression systems to control timing of FliF expression

By integrating these approaches, researchers can develop a comprehensive understanding of FliF's role in Brucella physiology and virulence, distinguishing primary functional roles from secondary effects on cellular physiology.

What emerging technologies could advance our understanding of FliF function in Brucella abortus?

Several cutting-edge technologies show promise for elucidating FliF function:

  • CRISPR-Cas9 genome editing:

    • Precise, scarless modifications to fliF to study specific domains

    • Creation of conditional knockdowns for essential regions

    • High-throughput mutagenesis screens

  • Advanced microscopy:

    • Super-resolution microscopy to visualize flagellar assembly in situ

    • Cryo-electron tomography to obtain structural information in native cellular context

    • Live-cell imaging with fluorescently tagged FliF to track dynamics

  • Single-cell technologies:

    • Single-cell RNA-Seq to identify population heterogeneity in flagellar expression

    • Mass cytometry for multiparameter analysis of flagellar protein expression

    • Microfluidics for real-time observation of individual bacterial responses

  • Systems biology approaches:

    • Network analysis integrating transcriptomic, proteomic, and metabolomic data

    • Machine learning to identify patterns in complex datasets

    • Mathematical modeling of flagellar assembly and regulation

These technologies could reveal previously unrecognized functions of FliF and provide a more comprehensive understanding of its role in Brucella pathogenesis.

How might comparative studies across Brucella species and biovars inform our understanding of FliF evolution and function?

Comparative studies across Brucella species and biovars can provide valuable insights:

  • Sequence analysis of fliF across Brucella species can identify conserved domains essential for function and variable regions that might contribute to host specificity

  • Heterologous complementation experiments can test functional conservation of FliF proteins from different Brucella species and biovars

  • Correlation of FliF sequence variations with differences in virulence, host preference, and tissue tropism

  • Evolutionary analysis to identify selective pressures on fliF genes within the Brucella genus

  • Comparison of flagellar gene regulation networks across species to understand adaptation to different ecological niches

Such comparative approaches could reveal how flagellar structures have adapted to diverse host environments and contribute to the characteristic pathogenesis patterns of different Brucella species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.