Recombinant Brucella abortus biovar 1 Immunogenic membrane protein YajC (yajC)

Shipped with Ice Packs
In Stock

Description

Genetic Structure and Identification

The yajC gene was discovered within a 2.6 kb DNA insert contained in a clone designated as MCB68 . Detailed nucleotide sequence analysis revealed two open reading frames (ORFs), with the first corresponding to the yajC gene and the second to the secD gene . The genomic organization suggests functional relevance, as both genes are involved in protein translocation systems in other bacterial species .

The identification of yajC in Brucella abortus represented the first demonstration of this protein in bacteria other than Escherichia coli, where it had previously been characterized . This finding expanded understanding of protein translocation systems across bacterial species and highlighted evolutionary conservation of this important cellular machinery.

Expression Systems

For research and immunological studies, the YajC protein has been successfully expressed in heterologous systems. The primary approach involves expressing YajC in Escherichia coli as a fusion protein with maltose binding protein (MBP) . This expression strategy facilitates purification and enhances protein solubility.

Additionally, researchers have demonstrated overexpression of YajC in B. abortus RB51 by cloning the gene with its putative promoter in a broad-host-range vector called pBBR1MCS . The resulting strain, designated RB51/pBByajC, produces elevated levels of YajC protein compared to wild-type bacteria, enabling detection in Western blot analyses that would not be possible with natural expression levels .

Antibody Responses

One of the most significant aspects of YajC is its immunogenicity. Western blot analyses have demonstrated that sera from mice vaccinated with live B. abortus RB51 recognize the YajC protein but not the associated SecD protein, despite both being expressed as recombinant fusion proteins . This selective antibody response suggests differential immunogenicity between these functionally related proteins.

Further investigations revealed that mice inoculated with various live Brucella strains, including B. abortus 19, B. abortus 2308, and B. melitensis RM1, produced antibodies recognizing the recombinant YajC protein . Importantly, the antibody response includes the IgG2a subisotype, which indicates a Th1-polarized immune response typically associated with protection against intracellular pathogens .

An interesting observation was that sera from mice immunized with killed B. abortus vaccines failed to react with recombinant YajC protein . This finding suggests that the immunogenic presentation of YajC differs substantially between live and killed vaccine preparations, with implications for vaccine design.

Cell-Mediated Immune Responses

The capacity of YajC to stimulate cell-mediated immunity has been evaluated through in vitro lymphocyte proliferation assays. Splenocytes from mice vaccinated with B. abortus RB51 demonstrated significant proliferation when stimulated with recombinant MBP-YajC fusion protein . This proliferative response was observed specifically in 3-day cultures but was not detected in 5-day cultures, indicating a distinct temporal pattern of cellular activation .

Beyond proliferation, YajC stimulation induced significant cytokine production. Specifically, splenocytes from vaccinated mice produced IFN-γ but not interleukin-4 (IL-4) when stimulated with the recombinant MBP-YajC fusion protein . This cytokine profile confirms the ability of YajC to induce a Th1-polarized immune response, considered essential for protection against intracellular bacteria like Brucella.

The quantitative data on IFN-γ production in response to various stimulants is presented in the following table :

StimulantConcentration of IFN-γ (ng/ml)
3-day cultures5-day cultures
Vaccinated miceNaive miceVaccinated miceNaive mice
Media
ConA30.55 ± 0.6528.31 ± 2.0027.96 ± 0.4326.05 ± 0.89
RB5129.63 ± 1.0029.12 ± 0.30
MBP-YajC0.42 ± 0.102.90 ± 0.89
MBP

While the levels of IFN-γ produced in response to MBP-YajC were significantly lower than those induced by whole bacterial antigens (RB51), the response was specific and statistically significant . Similar patterns have been observed with other recombinant Brucella antigens, including the L7/L12 protein, which has demonstrated protective capacity despite inducing relatively modest IFN-γ levels in vitro .

Protein Translocation and Bacterial Physiology

Based on sequence homology with YajC proteins from other bacteria, particularly Escherichia coli, the Brucella YajC protein is hypothesized to function in protein translocation . In E. coli, YajC associates with the SecD/SecF complex, which participates in the secretory (Sec) pathway responsible for transporting proteins across the bacterial membrane .

The genomic organization of yajC adjacent to secD in Brucella abortus further supports this functional prediction . The co-localization of these genes suggests coordinated expression and functional interaction, consistent with their proposed roles in protein translocation machinery.

Researchers have suggested that the functional role of B. abortus YajC may involve translocation of periplasmic or secretory proteins . This function could have significant implications for bacterial physiology, virulence, and interaction with host cells during infection.

Expression Patterns in B. abortus

An important characteristic of YajC is its low expression level in wild-type Brucella abortus . Similar to observations in E. coli, natural YajC expression in B. abortus is minimal, requiring overexpression for reliable detection . This low expression pattern may explain why mice vaccinated with killed B. abortus vaccines fail to develop detectable antibody responses to YajC .

Despite limited expression, YajC is produced at sufficient levels during active Brucella infection to stimulate immune responses, as evidenced by antibody development in mice infected with various live Brucella strains . This suggests that expression may be regulated in response to specific environmental conditions encountered during infection.

Immunological Basis for Vaccine Potential

The immunological properties of YajC make it a promising candidate for vaccine development against brucellosis . Several key characteristics support this potential:

  1. Ability to induce IgG2a antibodies, indicative of Th1-polarized immunity

  2. Capacity to stimulate lymphocyte proliferation in previously vaccinated animals

  3. Induction of IFN-γ production, a critical protective cytokine against intracellular pathogens

  4. Expression during natural infection, ensuring target relevance

These properties align with the established protective immune profile for brucellosis, which requires cell-mediated immunity with Th1 polarization and IFN-γ production .

Comparison with Other Brucella Antigens

In the context of other characterized Brucella antigens, YajC shows comparable immunological properties to proteins like L7/L12, which has demonstrated protective efficacy . While the levels of IFN-γ induced by YajC are relatively modest compared to whole-cell preparations, this does not necessarily preclude protective capacity .

The immunogenicity profile of YajC differs from that of the co-expressed SecD protein, which failed to induce detectable antibody responses in vaccinated mice . This differential immunogenicity between functionally related proteins highlights the selective nature of immune recognition and the importance of empirical evaluation for vaccine antigen selection.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipment is required, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, briefly centrifuge the vial to ensure the contents are collected at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize development according to your specifications.
Synonyms
yajC; BruAb1_0902; Sec translocon accessory complex subunit YajC; Immunogenic membrane protein YajC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-113
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
yajC
Target Protein Sequence
MFVTPAFAQASGSVVGPDMLMSILPFILIFVIMYFLIIRPQRTQMKKRQEMLNSVRRGDT VVTGGGIVGKVLKVVDDNELELEIADGVRIRVVRATLMDVRVKGEPVADNKNK
Uniprot No.

Target Background

Function
The SecYEG-SecDF-YajC-YidC holo-translocon (HTL) protein secretase/insertase is a supercomplex essential for protein secretion, insertion of proteins into membranes, and assembly of membrane protein complexes. While the SecYEG complex plays a crucial role in the assembly of numerous proteins and complexes, the SecDF-YajC-YidC subcomplex facilitates these functions.
Database Links
Protein Families
YajC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is YajC protein and how was it initially identified in Brucella abortus?

YajC is an immunogenic membrane protein identified in Brucella abortus through screening a genomic library of B. abortus strain 2308 for antigens that react with immunoglobulin G2a (IgG2a) antibodies from BALB/c mice vaccinated with B. abortus RB51. This screening approach specifically targeted proteins that could potentially stimulate a T-helper 1 (Th1) immune response, as IgG2a subisotype antibodies are indicative of such responses . The yajC gene was identified on a positive recombinant clone (clone MCB68) containing an insert of 2.6 kb. Nucleotide sequence analysis revealed two open reading frames (ORFs), with the first ORF encoding YajC and the second encoding SecD .

What is the genomic organization and sequence homology of Brucella abortus yajC?

The yajC gene in B. abortus is positioned adjacent to the secD gene, similar to the genomic organization found in several other bacterial species . Nucleotide sequence analysis of the clone containing yajC revealed significant sequence homology with YajC proteins from other bacterial species. This conservation suggests evolutionarily preserved functions across different bacterial genera. The close proximity of yajC to secD indicates potential functional relationships between these two proteins, possibly in protein secretion or membrane integrity maintenance .

What is the relationship between YajC and bacterial virulence in Brucella infections?

While YajC itself has not been directly characterized as a primary virulence factor like some other Brucella components (e.g., cyclic β-1,2-glucan), its immunogenic properties suggest potential involvement in host-pathogen interactions . Unlike classic virulence determinants such as toxins, pili, fimbria, and plasmids that Brucella lacks, YajC represents one of the antigenic components that may contribute to the bacterium's ability to establish intracellular infection . The protein appears to be expressed during infection and stimulates both humoral and cell-mediated immune responses, indicating its accessibility to the host immune system during natural infection .

What are the recommended methods for cloning and expressing recombinant Brucella abortus YajC?

Based on published research protocols, the following methodology is recommended for cloning and expressing YajC:

  • PCR amplification of the yajC gene from B. abortus genomic DNA (strain 2308 has been successfully used)

  • Design of primers with engineered restriction sites for directional cloning

  • Expression in E. coli using expression vectors such as pMalP2 or pMalC2 (New England Biolabs)

  • Expression as a fusion protein with maltose binding protein (MBP) at the amino terminus

  • Purification by affinity chromatography using amylose resin

The PCR conditions used successfully include: 10 mM Tris-HCl (pH 9.0) buffer and appropriate cycling parameters. After amplification, the PCR product can be digested with appropriate restriction enzymes and ligated into the expression vector .

How can recombinant YajC protein be purified to maintain its immunogenic properties?

Purification of recombinant YajC protein while preserving its immunogenic properties requires careful consideration of several factors:

  • Expression as an MBP fusion protein significantly improves solubility and facilitates purification via affinity chromatography with amylose resin

  • After binding to amylose resin, washing steps should be performed to remove contaminants

  • Elution using maltose (typically 10 mM) in an appropriate buffer

  • If needed, the MBP tag can be removed using a specific protease (depending on the vector design)

  • Further purification can be achieved through size exclusion chromatography

Researchers should verify protein purity via SDS-PAGE and confirm immunoreactivity through Western blot analysis using sera from Brucella-infected or vaccinated animals .

What expression systems have been validated for overexpression of functional YajC protein?

The E. coli expression system has been effectively validated for YajC protein production. Specifically, expression vectors pMalP2 and pMalC2 (New England Biolabs) have proven successful for producing recombinant YajC as a fusion protein with MBP . For expression in Brucella itself, broad-host-range vectors such as pBBR1MCS with chloramphenicol resistance have been used successfully. This system allowed for the introduction of the yajC gene along with its putative promoter into B. abortus RB51, creating strain RB51/pBByajC . This dual approach provides flexibility depending on research objectives - whether studying the protein's biochemical properties (E. coli system) or its functional role within Brucella (homologous expression).

What type of immune response does YajC protein stimulate in animal models?

YajC protein stimulates both humoral and cell-mediated immune responses in mice. Specifically:

  • Humoral response: Mice vaccinated with B. abortus strains (RB51, strain 19, strain 2308, or B. melitensis RM1) produce antibodies against YajC, demonstrating its immunogenicity .

  • Cell-mediated response: Splenocytes from mice vaccinated with B. abortus RB51, when stimulated in vitro with recombinant MBP-YajC fusion protein, showed:

    • Cellular proliferation

    • Production of gamma interferon (IFN-γ)

    • Absence of interleukin-4 (IL-4) production

This cytokine profile (IFN-γ positive, IL-4 negative) is characteristic of a Th1-biased immune response, which is considered protective against intracellular pathogens like Brucella. This finding is significant as it demonstrates YajC's ability to stimulate the type of immune response needed for protection against brucellosis .

How does the YajC-specific immune response compare to other Brucella immunogens?

While the search results don't provide direct comparative data between YajC and other specific Brucella immunogens, they do offer context for understanding its relative importance:

  • YajC induces both antibody production and cell-mediated immunity with a Th1 bias (IFN-γ production), similar to other protective Brucella antigens .

  • The study cited in the search results was the first to demonstrate YajC's involvement in immune responses to an infectious agent, highlighting its novel status as an immunogen .

  • Unlike some other Brucella components such as LPS that may inhibit IFN-γ secretion and promote IL-10 production (potentially subverting protective immunity), YajC appears to stimulate a more protective Th1-biased response .

  • Other Brucella proteins, such as BP26, BLS, and various Omps (outer membrane proteins), have also been proven highly immunogenic, but direct comparisons with YajC would require further targeted studies .

What is the potential of YajC as a component for subunit vaccine development against brucellosis?

YajC shows several characteristics that make it a promising candidate for inclusion in subunit vaccine development against brucellosis:

  • It stimulates a Th1-biased immune response characterized by IFN-γ production without IL-4, which is considered protective against intracellular pathogens like Brucella .

  • The protein is recognized by antibodies from mice infected with different Brucella strains, suggesting broad immunogenic potential across Brucella infections .

  • YajC's ability to induce cellular proliferation in splenocytes from vaccinated animals indicates potential for memory response development, a critical feature for vaccine efficacy .

  • Compared to attenuated live vaccines like B. abortus S19 that retain some virulence, a subunit approach using proteins like YajC could potentially offer improved safety profiles while maintaining protective immunogenicity .

The development of a YajC-based subunit vaccine would need to address several considerations, including appropriate adjuvant selection to enhance Th1 responses, optimal delivery methods, and combination with other immunogenic Brucella proteins for comprehensive protection .

How might YajC contribute to Brucella's intracellular survival mechanisms?

While the direct role of YajC in Brucella's intracellular survival is not fully elucidated in the provided search results, several hypotheses can be formulated based on available information:

  • YajC's genomic proximity to secD suggests potential involvement in protein secretion or membrane integrity systems that might influence bacterial adaptation to intracellular environments .

  • Unlike some Brucella virulence factors that actively suppress protective immunity (such as prpA, Btp1/TcpB, and LPS that can block IFN-γ secretion while promoting IL-10 production), YajC appears to stimulate protective immunity, suggesting it may not directly function as a virulence factor for immune evasion .

  • Brucella employs multiple mechanisms to evade innate immunity, such as modifying PAMPs to avoid recognition by TLRs, and possessing atypical LPS that affects complement activation. YajC could potentially play indirect roles in these processes through its membrane-associated functions .

Further research using YajC knockout mutants, similar to studies done with cyclic β-1,2-glucan synthetase mutants, would be valuable to determine if YajC deficiency affects intracellular multiplication or persistence in cellular and animal models .

What are the methodological approaches for studying YajC's role in host-pathogen interactions?

Several methodological approaches can be employed to investigate YajC's role in host-pathogen interactions:

  • Generation of yajC knockout mutants:

    • Create deletion mutants in virulent (e.g., B. abortus 2308) and attenuated (e.g., B. abortus S19) strains

    • Evaluate changes in virulence, intracellular survival, and host immune responses

    • Compare with wild-type strains in cellular infection models and animal studies

  • Cell culture infection models:

    • Infect macrophages and other relevant cell types with wild-type and yajC-deficient Brucella

    • Measure intracellular survival and replication rates

    • Analyze cytokine production profiles and cellular activation markers

  • Immunological assays:

    • Stimulate splenocytes from infected/vaccinated animals with purified YajC

    • Measure T-cell proliferation and cytokine production (particularly IFN-γ, TNF-α, IL-12)

    • Evaluate the balance of Th1/Th2 responses through cytokine profiling

  • In vivo challenge studies:

    • Immunize animals with recombinant YajC (with appropriate adjuvants)

    • Challenge with virulent Brucella strains

    • Assess protection through spleen colonization reduction and immune correlates of protection

What controls should be included when evaluating the immunogenicity of recombinant YajC protein?

When evaluating YajC immunogenicity, the following controls are essential:

  • Protein-specific controls:

    • Purified MBP alone (when using MBP-YajC fusion proteins) to distinguish responses to YajC from those to the fusion partner

    • Heat-denatured YajC to assess the importance of conformational epitopes

    • Other Brucella proteins to compare immunogenicity profiles

  • Immunological assay controls:

    • Splenocytes from unvaccinated/uninfected animals (negative control)

    • Splenocytes stimulated with known Brucella antigens or whole-cell lysates (positive control)

    • Measurement of multiple cytokines (IFN-γ, IL-4, IL-10, TNF-α) to characterize the type of immune response

  • Animal model controls:

    • Different mouse strains to account for genetic variability in immune responses

    • Time-course sampling to capture the dynamics of immune responses

    • Dose-dependent studies to determine optimal antigen concentrations

In the study examining YajC immunogenicity, researchers appropriately used splenocytes from saline-inoculated mice as negative controls and included MBP alone as a protein control when evaluating responses to the MBP-YajC fusion protein .

How can researchers address solubility and stability issues with recombinant YajC production?

Researchers may encounter solubility and stability issues when producing recombinant YajC. These challenges can be addressed through several approaches:

  • Fusion protein strategies:

    • The MBP fusion approach has proven successful for YajC expression and significantly enhances solubility

    • Alternative fusion partners (e.g., GST, SUMO, thioredoxin) could be explored if MBP fusion is suboptimal

    • Inclusion of appropriate linker sequences between YajC and fusion partners

  • Expression optimization:

    • Testing different E. coli strains (BL21, Rosetta, Arctic Express)

    • Optimizing induction conditions (temperature, IPTG concentration, induction time)

    • Using enriched media formulations for improved expression

  • Purification considerations:

    • Including protease inhibitors during extraction and purification

    • Testing different buffer compositions to enhance stability

    • Employing gentle elution conditions to maintain protein integrity

    • Storage with glycerol or other stabilizing agents at appropriate temperatures

  • Protein quality assessment:

    • Circular dichroism to verify proper folding

    • Size exclusion chromatography to confirm monomeric status

    • Western blotting with conformation-specific antibodies to assess native structure

What are the most promising future research avenues for understanding YajC's role in Brucella pathogenesis?

Several promising research directions could expand our understanding of YajC's role in Brucella pathogenesis:

  • Structural biology approaches:

    • Determining the three-dimensional structure of YajC through X-ray crystallography or cryo-EM

    • Identifying potential interaction partners through structural modeling and protein-protein interaction studies

    • Mapping immunodominant epitopes to understand the molecular basis of its immunogenicity

  • Comparative genomics and evolution:

    • Analyzing YajC sequence conservation across Brucella species and biovars

    • Investigating functional conservation with YajC homologs in other bacterial pathogens

    • Assessing selective pressure on yajC sequences to identify functionally important regions

  • Systems biology integration:

    • Transcriptomic analysis to determine yajC expression patterns during different stages of infection

    • Proteomics studies to identify YajC interaction networks

    • Metabolomic impacts of YajC function on bacterial physiology

  • Translational applications:

    • Evaluation of YajC as a diagnostic antigen for brucellosis detection

    • Assessment of YajC in combinatorial subunit vaccine formulations

    • Exploration of YajC-based immunotherapeutic approaches

The continued study of YajC within the broader context of Brucella virulence and immune evasion mechanisms will provide valuable insights for both fundamental understanding of host-pathogen interactions and applied vaccine development efforts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.