Recombinant Brucella abortus biovar 1 Large-conductance mechanosensitive channel (mscL)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
mscL; BruAb1_0344; Large-conductance mechanosensitive channel
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-138
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
mscL
Target Protein Sequence
MLKEFQEFALKGNMVDLAIGVIIGGAFGGLVNSIVNDIIMPIIGLITGGIDFSNMFIQLA GDPKTTLAAAREAGATIAYGNFITLLINFLIIAWVLFLVVKLMNRLKKREEAKPAPAAPS EEVLLTEIRDILAKQQKA
Uniprot No.

Target Background

Function
A mechanosensitive channel that opens in response to membrane stretch forces. It may play a role in regulating cellular osmotic pressure.
Database Links
Protein Families
MscL family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of B. abortus mscL protein and how does it compare to other bacterial mechanosensitive channels?

The B. abortus biovar 1 (strain 9-941) mscL protein forms a homopentameric structure with each subunit containing two transmembrane regions that gate via the bilayer mechanism. The amino acid sequence of the protein is: mLKEFQEFALKGNMVDLAIGVIIGGAFGGLVNSIVNDIIMPIIGLITGGIDFSNMFIQLAGDPKTTLAAAREAGATIAYGNFITLLINFLIIAWVLFLVVKLMNRLKKREEAKPAPAAPSEEVLLTEIRDILAKQQKA . Unlike MscS, which is heptameric, the B. abortus mscL channel is likely pentameric, similar to the well-studied Escherichia coli MscL (Ec-MscL) . The channel protein opens in response to stretch forces in the lipid bilayer and functions as a safety valve during osmotic shock .

What are the functional mechanisms of the mscL channel in B. abortus and how does it contribute to bacterial survival?

The mscL channel in B. abortus operates through a bilayer mechanism triggered by hydrophobic mismatch and changes in membrane curvature and/or transbilayer pressure profile . During the stationary phase and osmotic shock, mscL expression is upregulated to prevent cell lysis . The channel opens when membrane tension reaches threshold levels, creating a large pore (conductance of approximately 3 nS) that allows ions, water, and small proteins to pass through . This mechanism helps B. abortus maintain osmotic homeostasis during environmental stress, which is particularly important for this intracellular pathogen during the infection process and host cell colonization .

What are the optimal expression systems for producing recombinant B. abortus mscL protein?

Based on current research, E. coli expression systems have proven most effective for producing recombinant B. abortus proteins, including mscL. For optimal expression:

  • Vector selection: pCold-TF and pET28a expression vectors have demonstrated good yield for B. abortus recombinant proteins .

  • Host strains: E. coli DH5α and BL21 strains are commonly used hosts .

  • Induction conditions: Expression can be optimized using IPTG induction at 15-25°C to minimize inclusion body formation.

  • Fusion partners: Adding fusion tags like trigger factor (TF) can increase solubility and yield of recombinant proteins .

For specific mscL expression, the protein should be maintained in a lipid environment during purification to preserve its native conformation and functionality .

What purification methods yield the highest purity and functional integrity of recombinant B. abortus mscL?

For optimal purification of functional recombinant B. abortus mscL, a combination of approaches is recommended:

  • Affinity chromatography: HisTALON gravity columns have been successfully employed for the purification of recombinant B. abortus proteins when expressed with His-tags .

  • Buffer composition: A Tris-based buffer with 50% glycerol has been reported as optimal for mscL protein storage .

  • Denaturation conditions: If inclusion bodies form, purification under denaturation conditions followed by controlled refolding may be necessary .

  • Yield assessment: Bradford method can be used to estimate the yield of purified recombinant proteins, with reported yields of approximately 220 μg/mL of culture for other B. abortus recombinant proteins .

For maintaining functional integrity, it's crucial to handle the purified protein at 4°C and avoid repeated freezing and thawing cycles .

How effective are recombinant B. abortus mscL-based vaccines compared to traditional live attenuated vaccines?

While specific data on mscL-based vaccines is limited, research on other recombinant B. abortus proteins provides valuable insights:

Vaccine TypeProtection (log reduction)Immune Response TypeSide EffectsDuration of Immunity
Live attenuated (RB51)1.4-2.9 logsTh1 dominantLow compared to other live vaccinesLong-term
Live attenuated (S19)1.4-2.9 logsTh1 dominantPotentially virulent in pregnant animalsLong-term
Recombinant subunit vaccines0.5-1.5 logsPrimarily Th1MinimalRequires boosters
Combined subunit vaccinesUp to 0.94-1.1 logsEnhanced Th1MinimalRequires boosters

Research indicates that combined subunit vaccines containing multiple recombinant B. abortus proteins show greater efficacy than single protein vaccines . While mscL has not been specifically tested in combination vaccines, its membrane location and conserved nature make it a promising candidate for inclusion in next-generation subunit vaccine formulations .

What are the essential controls needed when evaluating the protective efficacy of recombinant B. abortus mscL in mouse models?

When evaluating protective efficacy of recombinant B. abortus mscL in mouse models, the following controls and experimental design elements are essential:

  • Control Groups:

    • PBS-treated negative control

    • Empty vector (e.g., pCold-TF) control to evaluate vector-induced immunity

    • RB51 or S19 live attenuated vaccine as positive control

    • Unrelated recombinant protein control

  • Mouse Strain Selection:

    • BALB/c mice (susceptible) for protection studies

    • C57BL mice (more resistant) for comparative immune response evaluation

    • Consider mice with specific immune defects to evaluate pathway-specific protection

  • Challenge Protocol:

    • Challenge with virulent B. abortus strain 2308 or 544

    • Standardized challenge dose (typically 5×10⁴ CFU)

    • Intraperitoneal route for consistent colonization

    • Evaluation at multiple time points (1-8 weeks post-challenge)

  • Outcome Measures:

    • Bacterial loads in spleen, liver, and lymph nodes

    • Splenomegaly assessment

    • Cytokine profiling (IFN-γ, IL-10, IL-6, TNF-α)

    • Antibody titers (IgG, IgG1, IgG2a/IgG2c)

What molecular techniques are most effective for characterizing the structure-function relationship of recombinant B. abortus mscL?

To effectively characterize the structure-function relationship of recombinant B. abortus mscL, researchers should employ a combination of techniques:

  • Structural Analysis:

    • X-ray crystallography for high-resolution structural determination

    • Cryo-electron microscopy for native state visualization

    • Computational modeling based on homology with resolved MscL structures (e.g., M. tuberculosis MscL)

    • Circular dichroism spectroscopy to verify secondary structure

  • Functional Characterization:

    • Patch-clamp electrophysiology to measure channel conductance and gating properties

    • Osmotic shock assays to evaluate protection against cell lysis

    • Fluorescence-based ion flux assays for high-throughput functional screening

    • Site-directed mutagenesis to identify key functional residues

  • Interaction Studies:

    • Lipid-protein interaction analysis using reconstituted proteoliposomes

    • Force application studies to determine tension thresholds for gating

    • Cross-linking experiments to confirm oligomeric state

  • In Silico Analysis:

    • Molecular dynamics simulations to study conformational changes

    • Protein-lipid interface modeling to understand bilayer mechanism

These approaches provide complementary data for understanding how mscL structure relates to its mechanosensitive properties in B. abortus .

How should researchers interpret discrepancies between in vitro mechanosensitive channel activity and in vivo protective efficacy of recombinant B. abortus mscL?

When faced with discrepancies between in vitro mechanosensitive channel activity and in vivo protective efficacy, researchers should consider several factors:

  • Protein Conformation: The native conformation of mscL in the bacterial membrane may differ from the recombinant protein conformation, affecting both function and immunogenicity. Comparing channel activity in artificial membranes versus bacterial cells can help identify such discrepancies .

  • Host-Pathogen Interactions: In vivo, the protective efficacy depends not only on the channel's function but also on complex host-pathogen interactions. Analyzing immune responses through cytokine profiling and antibody characterization can provide insights into why a functionally active channel might not confer expected protection .

  • Temporal Dynamics: The timing of mscL expression during infection versus experimental timelines can lead to discrepancies. Time-course studies measuring both channel activity and bacterial load can help resolve temporal inconsistencies .

  • Strain Variations: Differences between B. abortus strains may explain varying results. Whole genome sequencing and SNP analysis can identify genetic variations that might affect mscL function or expression across strains .

  • Statistical Analysis: Employ appropriate statistical methods to determine if apparent discrepancies are statistically significant. Multiple testing corrections should be applied when analyzing extensive datasets from protection studies .

What bioinformatic approaches are most valuable for analyzing potential epitopes and immunogenic regions of B. abortus mscL?

For comprehensive epitope analysis of B. abortus mscL, the following bioinformatic approaches are most valuable:

  • T-cell Epitope Prediction:

    • NetMHCpan for predicting MHC class I binding epitopes

    • ProPred and IEDB Analysis Resource for MHC class II epitope prediction

    • Class I and II epitope analysis is crucial as protective immunity against B. abortus requires both CD4+ and CD8+ T-cell responses

  • B-cell Epitope Prediction:

    • BepiPred for linear B-cell epitope prediction

    • DiscoTope for conformational epitope prediction

    • ElliPro for protein antibody complex analysis

    • Antibodies against surface-exposed regions of mscL may neutralize channel function

  • Structural Analysis:

    • Homology modeling for predicting 3D structure

    • Molecular dynamics simulations to identify structurally stable epitopes

    • Solvent accessibility analysis to identify surface-exposed regions

  • Comparative Analysis:

    • Sequence alignment with other Brucella species to identify conserved epitopes

    • Comparison with host proteome to avoid cross-reactivity

    • Analysis of epitope conservation across biovar 1 strains

  • Validation Approaches:

    • Synthetic peptide binding assays for predicted epitopes

    • Experimental verification using ELISA or ELISpot assays

    • In silico validation through molecular docking of epitopes to MHC molecules

These approaches should be used in combination to identify the most promising epitopes for vaccine development .

What are the major technical challenges in developing a stable, high-yield expression system for recombinant B. abortus mscL?

Researchers face several significant challenges when developing expression systems for recombinant B. abortus mscL:

  • Membrane Protein Solubility: As a transmembrane protein, mscL tends to form inclusion bodies when overexpressed. Approaches to address this include:

    • Using specialized membrane protein expression vectors

    • Fusion with solubility-enhancing tags like trigger factor (TF)

    • Expression at reduced temperatures (15-20°C)

    • Inclusion of specific detergents during purification

  • Functional Integrity: Maintaining the native conformation and functional properties of mscL requires:

    • Optimized lipid composition during purification

    • Reconstitution into liposomes or nanodiscs

    • Careful selection of detergents that don't disrupt the pentameric structure

    • Verification of mechanosensitive activity post-purification

  • Expression Yield: Increasing production yields requires:

    • Codon optimization for the expression host

    • Signal peptide optimization if secretion is desired

    • Systematic testing of induction parameters (temperature, inducer concentration, time)

    • Scale-up validation for consistent production

  • Protein Stability: Preventing degradation during expression and storage:

    • Use of protease-deficient expression hosts

    • Optimized storage conditions (50% glycerol, -20°C)

    • Avoidance of repeated freeze-thaw cycles

How might recombinant B. abortus mscL be exploited as a potential drug target, and what experimental approaches would best evaluate this potential?

Recombinant B. abortus mscL presents an intriguing target for novel antibacterial therapies, which can be evaluated through:

  • Targeted Drug Discovery:

    • High-throughput screening of small molecule libraries targeting mscL gating

    • Identification of compounds that force the channel to remain open, causing cellular damage through osmotic dysregulation

    • Structure-based drug design focusing on the channel's constriction points (similar to residues Leu19 and Val23 in E. coli MscL)

  • Validation Approaches:

    • Patch-clamp electrophysiology to confirm compound effects on channel gating

    • Growth inhibition assays using wild-type and mscL knockout strains

    • Time-kill assays to determine bactericidal versus bacteriostatic effects

    • Intracellular infection models to assess efficacy against B. abortus in its natural niche

  • Specificity Assessment:

    • Comparative analysis with human mechanosensitive channels to ensure selectivity

    • Testing against other bacterial species to determine spectrum of activity

    • Molecular docking studies to predict binding specificity

  • Delivery Strategies:

    • Liposomal formulations to enhance delivery to intracellular bacteria

    • Combination therapy approaches with conventional antibiotics

    • Investigation of synergistic effects with osmotic stress inducers

  • Resistance Development:

    • Serial passage experiments to assess potential for resistance development

    • Whole genome sequencing to identify compensatory mutations

    • Fitness cost analysis of resistant mutants

The pharmacological potential of mscL may involve discovering new antibiotics to combat multiple drug-resistant bacterial strains, as mechanosensitive channels represent an underexplored target class in antimicrobial development .

How does B. abortus mscL structure and function compare across different biovars and strains, and what are the implications for research?

Research indicates significant variations in mscL across B. abortus biovars that impact experimental design:

  • Sequence Variation:

    • Whole genome sequencing has revealed that while the core genome of B. abortus is highly conserved (95% coverage across strains), specific variations exist in membrane proteins

    • Phylogenetic analyses have identified five major genotypes, with biovar 1 showing more genetic stability than other biovars

    • These variations must be considered when designing broad-spectrum vaccines or diagnostics targeting mscL

  • Functional Differences:

    • The gating properties and mechanosensitivity thresholds may vary between strains

    • Expression levels of mscL differ during various growth phases and stress conditions

    • These differences can affect osmotic stress responses and pathogenicity between biovars

  • Research Implications:

    • Strain selection critically affects experimental outcomes

    • Reference strains (e.g., 9-941, 2308, 544) should be clearly specified in methodologies

    • Multiple strain testing is recommended for comprehensive characterization

  • Diagnostic Considerations:

    • Strain-specific variations can impact diagnostic test development

    • Targeting conserved regions of mscL is essential for broadly applicable diagnostics

What approaches should be used to study the role of mscL in B. abortus pathogenesis and host interaction?

To comprehensively study mscL's role in B. abortus pathogenesis, researchers should employ:

  • Genetic Manipulation:

    • Creation of mscL knockout mutants using CRISPR-Cas9 or homologous recombination

    • Complementation studies to confirm phenotypes

    • Conditional expression systems to study temporal requirements

    • Site-directed mutagenesis to identify key functional residues

  • Infection Models:

    • Macrophage cell lines (J774A.1, RAW 264.7) for initial screening

    • Primary macrophages for physiologically relevant responses

    • Mouse models (BALB/c for susceptibility, C57BL for resistance)

    • Natural host models (bovine) for translational relevance

  • Temporal and Spatial Analysis:

    • Time-course studies of mscL expression during infection

    • Immunofluorescence microscopy to track subcellular localization

    • Single-cell analysis to assess population heterogeneity

    • Tissue-specific expression in different infection sites

  • Host Response Assessment:

    • Cytokine profiling (IFN-γ, IL-10, TNF-α, IL-6)

    • Analysis of macrophage activation markers

    • Measurement of apoptosis and necrosis in infected cells

    • Assessment of mscL-specific antibody and T-cell responses

  • Stress Response Studies:

    • Osmotic shock survival comparisons between wild-type and mscL mutants

    • Investigation of mscL role during phagolysosomal stress

    • Analysis of cross-talk between mechanosensing and other stress responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.