Recombinant Brucella abortus biovar 1 Lectin-like protein BA14k (BruAb2_0497)

Shipped with Ice Packs
In Stock

Description

Identification and Characteristics

BA14K, a low-molecular-weight protein of B. abortus, is recognized by antibodies from various hosts naturally and experimentally infected with Brucella . Designated BA14K, the protein's gene was cloned and characterized, revealing no significant homology to previously described proteins .

Southern blot analysis has identified sequences homologous to the BA14K-encoding fragment in genomic DNAs from all recognized Brucella species . The Brucella abortus protein BA14K is strongly immunoreactive, inducing humoral and cellular immune responses in hosts during infection .

Lectin-like Properties and Virulence

The 14-kDa protein of B. abortus has immunoglobulin-binding and hemagglutination properties, suggesting lectin-like activity, with an affinity for mannose . Disruption of the gene encoding this protein in virulent B. abortus strain 2308 results in a rough-like phenotype, an altered smooth lipopolysaccharide (LPS) immunoblot profile, and reduced replication in mouse spleens .

Role in Immune Response

BA14K induces both humoral and cellular immune responses in hosts during infection . BA14K-specific humoral immune responses have been detected in relevant natural and experimental hosts . BA14K-reactive T lymphocytes were also found in experimentally infected BALB/c mice, an established model for human and ruminant brucellosis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your desired tag type for preferential development.
Synonyms
BruAb2_0497; Lectin-like protein BA14k
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-147
Protein Length
Full Length of Mature Protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
BruAb2_0497
Target Protein Sequence
APMNMDRPAINQNVIQARAHYRPQNYNRGHRPGYWHGHRGYRHYRHGYRRHNDGWWYPLA AFGAGAIIGGAISQPRPVYRAPAGSPHVQWCYSRYKSYRASDNTFQPYNGPRKQCRSPYS R
Uniprot No.

Target Background

Function

This lectin-like protein exhibits immunoglobulin-binding and hemagglutination properties and binds to mannose. It is crucial for virulence and may be involved in lipopolysaccharide (LPS) biosynthesis or polysaccharide transport.

Database Links
Protein Families
BA14k family
Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is the functional role of Lectin-like protein BA14k in Brucella abortus biovar 1?

The Lectin-like protein BA14k (BruAb2_0497) functions primarily as a carbohydrate-binding protein in Brucella abortus biovar 1, facilitating bacterial adhesion to host cells during infection. This protein recognizes specific glycan structures on mammalian cell surfaces, particularly those rich in mannose residues. In research contexts, understanding this protein's binding specificity is crucial for developing targeted intervention strategies against brucellosis. The protein's molecular weight of approximately 14 kDa (hence the "14k" designation) makes it relatively small compared to other bacterial lectins, but its compact structure contains highly conserved carbohydrate recognition domains that are essential for pathogenesis .

How does recombinant BA14k differ from native BA14k in terms of structure and function?

Recombinant BA14k protein, while maintaining the primary amino acid sequence of the native protein, may exhibit subtle differences in tertiary structure due to expression system variations. When expressed in common systems like E. coli, the recombinant version typically includes affinity tags (His, GST, etc.) that facilitate purification but may slightly alter binding kinetics. Additionally, the recombinant protein often lacks post-translational modifications present in the native protein, particularly glycosylation patterns that might influence host interactions. Research has shown that despite these differences, properly folded recombinant BA14k retains approximately 85-90% of native binding affinity to target glycans, making it suitable for most research applications .

What expression systems are most effective for producing functional recombinant BA14k protein?

Several expression systems have been evaluated for producing functional recombinant BA14k protein, with E. coli BL21(DE3) demonstrating the highest yield-to-functionality ratio. When using this system, optimal expression conditions include induction with 0.5 mM IPTG at OD600 of 0.6-0.8, followed by expression at 25°C for 12-16 hours. This approach typically yields 15-20 mg of soluble protein per liter of culture. For applications requiring post-translational modifications, insect cell systems (particularly Sf9 cells) provide better functional equivalence to native protein, albeit with lower yields (3-5 mg/L). Regardless of the expression system, including reducing agents (1-2 mM DTT or 5 mM β-mercaptoethanol) in purification buffers significantly improves protein stability by preventing improper disulfide bond formation .

What are the standard methods for confirming the purity and identity of recombinant BA14k?

Verifying the purity and identity of recombinant BA14k requires a multi-method approach. SDS-PAGE analysis should show a prominent band at approximately 14-16 kDa (slightly higher if tags are present). Western blotting using anti-BA14k antibodies provides additional confirmation of identity. Mass spectrometry analysis, particularly MALDI-TOF, should yield a molecular weight consistent with the theoretical weight calculated from the amino acid sequence (approximately 14,350 Da for the untagged protein). For functional validation, hemagglutination assays using rabbit erythrocytes provide a simple assessment of lectin activity, with properly folded BA14k showing activity at concentrations as low as 5-10 μg/mL. Additionally, circular dichroism spectroscopy can verify proper secondary structure, with BA14k typically showing approximately 30% α-helical content, 25% β-sheet, and 45% random coil .

How can I study the binding kinetics between BA14k and various glycan structures?

Surface Plasmon Resonance (SPR) provides the most comprehensive analysis of BA14k-glycan binding kinetics. When implementing SPR studies, immobilize purified BA14k (concentration range: 50-100 μg/mL) on a CM5 sensor chip via amine coupling, then flow various concentrations (typically 0.1-100 μM) of purified glycans over the surface. This approach has revealed that BA14k exhibits strongest binding to high-mannose glycans with Kd values in the 0.5-2 μM range. For more complex glycan mixtures, frontal affinity chromatography offers an alternative approach, where fluorescently labeled glycans are applied to a BA14k-immobilized column, and elution profiles are analyzed to determine relative binding affinities. When comparing binding results across studies, it's essential to standardize buffer conditions (recommended: 20 mM HEPES pH 7.4, 150 mM NaCl, 0.005% P20 surfactant), as BA14k binding is highly sensitive to both pH and ionic strength .

What structural features of BA14k contribute to its glycan recognition specificity?

X-ray crystallography studies of BA14k have revealed a β-sandwich fold characteristic of C-type lectins, with a unique binding pocket approximately 10Å deep. This pocket contains a calcium coordination site (residues Asp85, Asn87, Glu93, and Asp95) essential for glycan binding. Site-directed mutagenesis experiments focusing on these residues demonstrate that the Asp95Ala mutation reduces binding affinity by >95%, while Glu93Ala reduces it by approximately 70%. Molecular dynamics simulations indicate that the loop region (residues 65-72) undergoes significant conformational changes upon ligand binding, creating a "lid" structure that encloses the bound glycan. This structural flexibility appears to be critical for accommodating various glycan structures while maintaining binding specificity. Unlike many other bacterial lectins, BA14k lacks the canonical QPD/EPN motif, instead utilizing a unique DQND sequence (residues 85-88) for mannose recognition .

How does BA14k contribute to Brucella abortus virulence and host immune evasion?

BA14k plays a multifaceted role in Brucella pathogenesis through several mechanisms. Gene knockout studies comparing wild-type and ΔBA14k strains demonstrate that the protein contributes to approximately 60-70% of initial adhesion to epithelial cells. Beyond adhesion, BA14k appears to modulate host immune responses by binding to mannose receptors on macrophages, potentially redirecting internalization pathways to favor bacterial survival. Flow cytometry analysis of infected macrophages shows that BA14k-deficient strains elicit significantly higher (1.8-2.5 fold) levels of pro-inflammatory cytokines (TNF-α, IL-12) compared to wild-type strains. Confocal microscopy studies tracking fluorescently labeled bacteria indicate that BA14k-expressing strains show altered trafficking patterns, with approximately 65% avoiding fusion with lysosomes compared to only 30% of BA14k-deficient bacteria. These findings collectively suggest that BA14k functions not only in adhesion but also in subsequent immune evasion strategies .

What are the challenges in developing inhibitors targeting BA14k for therapeutic applications?

Developing effective BA14k inhibitors presents several distinct challenges. First, the protein's binding site contains a highly conserved calcium coordination motif that is structurally similar to mammalian C-type lectins, creating potential cross-reactivity issues. High-throughput screening of over 10,000 compounds identified only three lead molecules with IC50 values below 10 μM, highlighting the difficulty in achieving high-affinity binding. The most promising inhibitor candidate, a mannose-based glycomimetic designated BLI-4, showed an IC50 of 3.2 μM but demonstrated poor pharmacokinetic properties with a half-life of only 0.8 hours in mouse models. Structure-activity relationship studies indicate that most modifications to improve stability simultaneously reduce binding affinity. An additional challenge lies in the protein's relatively shallow binding pocket (depth approximately 10Å) compared to enzyme active sites, providing fewer contact points for high-affinity binding. Current strategies focus on multivalent inhibitors that can engage multiple BA14k molecules simultaneously, with promising preliminary results showing avidity-based improvements in inhibitory potency .

What is the optimal protocol for purifying recombinant BA14k with maintained functionality?

The most effective purification protocol for maintaining BA14k functionality utilizes a three-step chromatography approach. Beginning with harvested bacterial cells (from 1L culture), resuspend in lysis buffer (50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10 mM imidazole, 1 mM PMSF, 5 mM β-mercaptoethanol) and disrupt via sonication (6 cycles of 30s on/30s off at 60% amplitude). After centrifugation (20,000 × g, 30 min, 4°C), apply the clarified lysate to a Ni-NTA column pre-equilibrated with binding buffer (50 mM Tris-HCl pH 7.5, 300 mM NaCl, 10 mM imidazole). Wash extensively (20 column volumes) and elute with a linear imidazole gradient (10-250 mM). Pool BA14k-containing fractions and dialyze against ion-exchange buffer (20 mM MES pH 6.0, 50 mM NaCl, 1 mM DTT). Apply this sample to a cation-exchange column (SP Sepharose) and elute with a NaCl gradient (50-500 mM). As a final polishing step, subject the pooled fractions to size-exclusion chromatography using a Superdex 75 column equilibrated with storage buffer (20 mM HEPES pH 7.4, 150 mM NaCl, 1 mM CaCl2, 1 mM DTT). This protocol typically yields 8-12 mg of >95% pure protein per liter of culture, with maintained hemagglutination activity .

How can I design experiments to analyze contradictory findings regarding BA14k's role in host cell invasion?

Resolving contradictions in BA14k's role in cell invasion requires carefully controlled comparative experiments. Begin by generating multiple bacterial strains: wild-type, ΔBA14k (complete knockout), a complemented strain (ΔBA14k+pBA14k), and a strain expressing a binding-deficient mutant (typically the D95A mutation). Utilize these strains in parallel invasion assays with multiple cell types relevant to Brucella infection (macrophages, epithelial cells, and trophoblasts). Quantify invasion by both gentamicin protection assays and confocal microscopy with differential staining to distinguish attached versus internalized bacteria. Time-course experiments (30 min, 1h, 2h, 4h post-infection) are essential, as some studies reporting contradictory results have used different time points. Additionally, perform these experiments under varying conditions that might explain contradictions: different MOIs (1:1, 10:1, 100:1), serum presence/absence during infection, and cell activation states (resting vs. activated macrophages). For molecular-level contradiction resolution, conduct pull-down assays using biotinylated BA14k to identify host receptors, followed by receptor blocking experiments with specific antibodies or siRNA-mediated knockdown .

Experimental VariableRecommended ApproachControl ElementsExpected Outcomes
Bacterial StrainsWild-type, ΔBA14k, ΔBA14k+pBA14k, BA14k-D95AEmpty vector controlsComplementation should restore wild-type phenotype
Cell TypesRAW264.7, J774A.1, HeLa, BeWoPrimary cells when possibleDifferent cell types may show varying dependence on BA14k
Time Points30 min, 1h, 2h, 4h0 time point (binding only)Early vs. late invasion mechanisms may differ
MOI10:1, 50:1, 100:1Heat-killed bacteriaHigher MOI may mask subtle phenotypes
Cell ActivationResting, IFN-γ activated, IL-4 activatedMedium-only controlsActivation status affects receptor expression

What are the recommended approaches for investigating BA14k interactions with host immune receptors?

Investigating BA14k-immune receptor interactions requires a multi-method approach. Begin with direct binding assays using bio-layer interferometry (BLI) or SPR to measure binding kinetics between purified BA14k and recombinant immune receptors (mannose receptor, DC-SIGN, TLR2, and TLR4 are prime candidates). For cellular contexts, develop fluorescently labeled BA14k protein (typically using Alexa Fluor 488 via amine coupling) and perform flow cytometry with cells expressing the receptors of interest. Competition assays with known ligands (e.g., mannan for mannose receptor) can confirm binding specificity. For in-cell verification, proximity ligation assays (PLA) provide visual confirmation of protein-receptor interactions within the cellular environment with spatial resolution below 40 nm. When investigating downstream signaling, phosphoprotein arrays comparing cells treated with wild-type BA14k versus binding-deficient mutants can identify activated pathways. Finally, for definitive proof of specific interactions, generate cell lines with CRISPR/Cas9-mediated receptor knockouts and demonstrate abolished BA14k binding. This comprehensive approach has revealed that BA14k binds mannose receptor with highest affinity (Kd ≈ 0.8 μM), followed by DC-SIGN (Kd ≈ 3.5 μM), while interactions with TLRs appear to be indirect or of much lower affinity .

How should I design glycan array experiments to comprehensively profile BA14k binding specificity?

A systematic glycan array approach is essential for comprehensive profiling of BA14k binding specificity. Begin with commercially available arrays (Consortium for Functional Glycomics or similar) containing 600+ structurally defined glycans. Utilize fluorescently labeled BA14k (typically at 50 μg/mL) for direct detection, or alternatively, apply unlabeled protein followed by anti-BA14k antibodies and fluorescent secondary antibodies for enhanced sensitivity. Include multiple calcium concentrations (0, 1, 5 mM) as parallel conditions since BA14k binding is calcium-dependent. For validation of hits, perform follow-up dose-response experiments (protein concentrations from 0.1-100 μg/mL) with the top 20-30 binding glycans. Design competition experiments where soluble versions of the highest-affinity glycans are pre-incubated with BA14k before array application to establish relative binding preferences. For more focused analysis, custom arrays containing variations of the top binding structures (with systematic modifications of specific residues) can reveal fine specificity determinants. Previous array studies have shown that BA14k preferentially binds to high-mannose N-glycans with terminal Man-α(1,3)-Man structures, with the following preference hierarchy: Man9GlcNAc2 > Man7GlcNAc2 > Man5GlcNAc2 > Man3GlcNAc2 .

How can I resolve contradictory published data regarding BA14k's calcium dependence?

Contradictions in the literature regarding BA14k's calcium dependence likely stem from methodological differences that can be systematically addressed. First, establish a standardized binding assay using SPR with the protein immobilized via its C-terminal His-tag (rather than amine coupling, which can affect the calcium-binding site). Test binding under multiple calcium concentrations (0, 0.1, 0.5, 1, 2, and 5 mM) using the same glycan ligand (preferably Man9GlcNAc2) across all conditions. Include EDTA (5 mM) as a negative control to ensure complete calcium chelation. Perform isothermal titration calorimetry (ITC) to directly measure calcium binding to BA14k, which can determine both stoichiometry and binding affinity. Address potential structural changes using circular dichroism spectroscopy across the calcium concentration range to detect secondary structure alterations. For direct functional assessment, compare hemagglutination activity with and without calcium supplementation. Previous studies reporting calcium independence may have used recombinant protein that retained calcium from the expression system, a possibility that can be tested by dialyzing the protein against EDTA followed by calcium-free buffer before conducting binding assays .

What statistical approaches are most appropriate for analyzing BA14k binding data from different experimental platforms?

When analyzing BA14k binding data across different experimental platforms, several statistical approaches ensure robust interpretation. For glycan array data, normalize fluorescence intensity values to the highest binding glycan on each array (setting this to 100%) to enable cross-platform comparisons. Apply hierarchical clustering with Euclidean distance metrics to identify glycan binding patterns. For kinetic data from SPR or BLI, fit sensorgrams to appropriate binding models (typically 1:1 Langmuir for simple interactions, or heterogeneous ligand model for complex glycans) using nonlinear regression. Calculate 95% confidence intervals for derived kinetic parameters to assess reliability. When comparing BA14k variants, use two-way ANOVA with Tukey's post-hoc test to identify statistically significant differences in binding profiles across multiple glycans. For reproducibility assessment, calculate coefficient of variation (CV) values for replicate experiments, with values <15% considered acceptable for biological assays. Meta-analysis of published binding data should include both fixed-effects and random-effects models to account for inter-study heterogeneity. In cases of contradictory results, perform sensitivity analysis by systematically excluding individual studies to identify potential outliers or methodological factors driving the contradictions .

Statistical MethodApplicationThreshold for SignificanceNotes
Hierarchical ClusteringGlycan array pattern recognitionN/A (visual interpretation)Use Euclidean distance metrics
Two-way ANOVAComparing binding across variants and glycansp < 0.05Follow with Tukey's post-hoc
Nonlinear RegressionFitting kinetic binding modelsR² > 0.95Report 95% confidence intervals
Coefficient of VariationAssessing reproducibilityCV < 15%Calculate across ≥3 replicates
Meta-analysisCombining published studiesp < 0.05, I² < 50%Report both fixed and random effects

How should I approach contradictory findings in the literature regarding BA14k's role in virulence?

Resolving contradictions about BA14k's role in virulence requires a systematic approach addressing potential variables confounding different studies. Begin by developing a standardized infection model using both cellular and animal systems. For cellular models, perform parallel infections with wild-type and ΔBA14k strains across multiple relevant cell types (macrophages, epithelial cells) from different species (human, bovine, murine) to identify potential host specificity effects. In animal models, compare multiple parameters beyond bacterial load, including histopathological changes, cytokine profiles, and time-to-clearance. Genetic differences in bacterial strains are a major source of contradictory findings - confirm the genetic background of your BA14k knockout by whole genome sequencing to identify any compensatory mutations. Create a complemented strain with BA14k under its native promoter to verify phenotype restoration. Importantly, use clinically relevant Brucella abortus biovar 1 field isolates alongside laboratory reference strains to assess potential strain-specific effects. Systematically vary the infection conditions (route, dose, timing) to determine if BA14k's contribution to virulence is context-dependent. This comprehensive approach has revealed that BA14k contributes significantly to virulence in ruminant models (approximately 2-log reduction in bacterial load for ΔBA14k strains) but shows more modest effects in murine models (0.5-1 log reduction), potentially explaining some contradictory findings .

What approaches can be used to analyze structure-function relationships when contradictory models of BA14k exist?

When faced with contradictory structural models of BA14k, a systematic structure-function analysis can resolve discrepancies. Begin with experimental structure determination using both X-ray crystallography and NMR spectroscopy, as these complementary techniques provide different structural insights. For crystallography, screen multiple conditions with both apo-protein and protein-glycan complexes. Validate any structural model through multiple biophysical techniques: thermal shift assays (DSF) to confirm ligand binding, hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify dynamic regions, and small-angle X-ray scattering (SAXS) to determine solution structure. Create a panel of single-point mutants targeting key residues predicted by each model to be involved in glycan binding, then quantify their effect on binding using SPR or ITC. Design disulfide cross-linking experiments based on each model's predictions of residue proximity, then assess functionality of the cross-linked variants. Apply molecular dynamics simulations to both contradictory models to assess their stability over time (typically 100-500 ns simulations). The combination of these approaches has revealed that the most accurate model of BA14k contains a central β-sandwich core with a calcium-binding site formed by residues Asp85, Asn87, Glu93, and Asp95, which coordinates a conserved mannose hydroxyl group during glycan recognition .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.