Recombinant Brucella abortus biovar 1 NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Functional Role in Brucella abortus

  • Metabolic Adaptation: NADH-quinone oxidoreductase is essential for energy production via oxidative phosphorylation. During the stationary growth phase, B. abortus downregulates nuoK and other subunits (e.g., nuoB, nuoD), indicating metabolic slowdown to conserve energy under nutrient-limited conditions .

  • Virulence Link: While not directly a virulence factor, nuoK supports bacterial survival under oxidative stress. Copper-zinc superoxide dismutase (Cu/ZnSOD) and manganese transporter MntH, both upregulated in stationary phase, depend on efficient redox homeostasis facilitated by nuoK .

Diagnostic and Immunological Studies

  • ELISA Development: Recombinant nuoK is commercially available for antibody detection assays, aiding brucellosis diagnosis .

  • Antigenic Potential: Its conserved structure makes it a candidate for epitope mapping and vaccine design .

Drug Target Identification

  • Essential Gene Analysis: Subtractive genomics identified nuoK as a non-homologous protein between B. abortus and cattle (Bos taurus), highlighting its potential as a species-specific therapeutic target .

  • Pathway Inhibition: Targeting NADH-quinone oxidoreductase could disrupt bacterial energy metabolism, a strategy explored for novel antibacterials .

Proteomic Insights

  • Stationary-Phase Adaptation: Proteomic profiling revealed nuoK downregulation during metabolic shifts, correlating with reduced energy expenditure and increased stress resistance .

  • Interactions with Virulence Systems: The Type IV Secretion System (T4SS), critical for intracellular survival, is regulated alongside redox enzymes like nuoK, suggesting integrated stress response mechanisms .

Technical Considerations

  • Storage: Lyophilized powder or glycerol stocks recommended for long-term stability .

  • Reconstitution: Optimized in Tris/PBS buffer (pH 8.0) with trehalose to prevent aggregation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your requirements for preferential development of a specific tag.
Synonyms
nuoK; BruAb1_0826; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
nuoK
Target Protein Sequence
MEIGIAHYLTVSAILFTLGVFGIFLNRKNVIVILMSIELILLSVNLNFVAFSSQLGDLVG QVFALFVLTVAAAEAAIGLAILVVFFRNRGSIAVEDVNVMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation; for every two electrons transferred, four protons are translocated across the cytoplasmic membrane, thus generating a proton gradient that stores redox energy.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing recombinant Brucella proteins?

Several expression systems have demonstrated efficacy for producing recombinant Brucella proteins, with selection depending on research objectives and protein characteristics. For nucleoside diphosphate kinase (Ndk), researchers successfully employed the pMAL expression system for PCR amplification and subsequent protein purification, yielding functional recombinant protein capable of inducing immune responses in mice . Another approach documented in the literature involves the pBEV vector system, which has been used for expression of foreign proteins in B. abortus strain S19, allowing for in vivo expression during experimental infection . When selecting an expression system for nuoK, researchers should consider protein solubility, post-translational modifications, and whether native conformation is required for functional studies. Expression systems that maintain the integrity of membrane proteins are particularly important for nuoK as it is a transmembrane component of the electron transport chain complex. Testing multiple expression systems in parallel often yields the best results, as protein expression efficiency can vary significantly between different recombinant proteins from the same organism.

What are the standard purification methods for recombinant membrane proteins from Brucella?

Purification of recombinant membrane proteins like NADH-quinone oxidoreductase subunit K requires specialized approaches due to their hydrophobic nature and structural complexity. Initial extraction typically involves detergent solubilization using mild non-ionic detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin to maintain protein folding and function. For affinity-based purification, fusion tags such as polyhistidine (His-tag) or maltose-binding protein (MBP) are commonly employed, with the latter being successfully used for purification of recombinant Ndk from B. abortus as documented in research studies . Size exclusion chromatography provides further purification while preserving native protein complexes, which is particularly important for multi-subunit complexes like NADH-quinone oxidoreductase. Protein purity should be assessed using SDS-PAGE and Western blotting with antibodies specific to the target protein or fusion tag. Mass spectrometry analysis is frequently used to confirm protein identity, as demonstrated in proteomic studies of B. abortus that achieved identification of approximately 74.5% of the predicted proteome . Researchers should be aware that purification yields for membrane proteins are typically lower than for soluble proteins, requiring optimization of growth conditions and extraction protocols to maximize recovery.

How can researchers confirm the functional integrity of purified recombinant nuoK?

Confirming the functional integrity of purified recombinant NADH-quinone oxidoreductase subunit K requires multiple complementary approaches focusing on both structural and enzymatic characteristics. Electron transfer activity can be measured spectrophotometrically using artificial electron acceptors such as ferricyanide or 2,6-dichlorophenolindophenol (DCPIP) in the presence of NADH, with activity compared to crude bacterial membranes as a positive control. Circular dichroism spectroscopy provides valuable information about secondary structure content, ensuring the recombinant protein maintains proper folding comparable to native protein. For membrane proteins like nuoK, reconstitution into liposomes or nanodiscs followed by measurement of proton pumping activity offers a more physiologically relevant assessment of function. Thermal shift assays can evaluate protein stability under various buffer conditions, helping optimize storage parameters. Additionally, researchers should consider analyzing the protein by native PAGE to confirm incorporation into the complete NADH-quinone oxidoreductase complex if co-expressed with other subunits. These functional assays are particularly important when developing nuoK as a potential vaccine candidate, as proper conformation is likely essential for inducing protective immune responses.

What strategies can optimize expression of recombinant nuoK to enhance immunogenicity?

Optimizing expression of recombinant NADH-quinone oxidoreductase subunit K for immunological studies requires careful consideration of expression systems, purification methods, and adjuvant formulations. Codon optimization for the expression host can significantly increase protein yields by aligning codon usage with the host's preference, particularly important for membrane proteins with typically lower expression levels. Expression as a fusion protein with immunogenic carriers like MBP can enhance both solubility and immunogenicity, as demonstrated with recombinant Ndk of B. abortus which induced strong IgG production in mice, particularly elevated IgG2a compared to IgG1 with titers of 5.2 and 4.8, respectively . When designing expression constructs, researchers should consider including conformationally important regions while potentially excluding highly hydrophobic transmembrane segments that may interfere with proper folding. For in vivo expression, attenuated B. abortus strains like S19 have been successfully used to express foreign proteins while maintaining the strain's low pathogenicity and protective capabilities . The optimal approach may combine purified recombinant protein for primary immunization followed by attenuated live vector boosting, potentially enhancing both humoral and cell-mediated immune responses. Monitoring of cytokine profiles, particularly IFN-γ production, is essential for evaluating cell-mediated immunity induction, which is crucial for protection against intracellular pathogens like Brucella.

What mouse models are most appropriate for evaluating nuoK-based vaccine candidates?

BALB/c mice represent the gold standard model for evaluating Brucella vaccine candidates, including potential nuoK-based formulations, due to their well-characterized immune responses and susceptibility to infection. When designing challenge studies, researchers typically administer approximately 2 × 10^7 CFU of virulent B. abortus intraperitoneally, consistent with protocols used in published B. abortus vaccine studies . Evaluation of vaccine efficacy should include multiple parameters: splenomegaly assessment, bacterial burden quantification in the spleen, and comprehensive immunological profiling. The timeline for challenge studies should account for the natural progression of B. abortus infection in mice, with significant splenomegaly typically observed around days 18-20 post-infection and bacterial clearance occurring around day 30 in mice with effective immune control . Immunological assessment should include both humoral markers (IgG, IgG1, and IgG2a titers) and cellular immunity parameters (IFN-γ, TNF, MCP1, and IL-6 production), with emphasis on IFN-γ as a critical cytokine for Brucella control . To comprehensively evaluate protection, research designs should incorporate both short-term protection (2-4 weeks post-challenge) and long-term memory (≥8 weeks post-challenge) timepoints. Control groups must include both non-immunized mice and mice immunized with established vaccine strains such as B. abortus S19 to provide meaningful comparative data.

How does nuoK expression change under different stress conditions relevant to host infection?

Understanding nuoK expression dynamics under various stress conditions provides valuable insights into its potential role during host infection and may inform vaccine development strategies. While specific data on nuoK regulation is limited, proteomic studies of B. abortus under various stress conditions relevant to intracellular survival have identified differential protein expression patterns that likely extend to electron transport chain components. Research has demonstrated that B. abortus experiences multiple simultaneous stresses during intracellular infection, with survival rates ranging from 3.17% to 73.17% under experimental stress conditions designed to mimic the intracellular environment . To investigate nuoK expression specifically, researchers should consider quantitative PCR analysis of nuoK transcription under conditions including oxidative stress (H₂O₂), nitrosative stress (GSNO), acidic pH (pH 4.5), nutrient limitation, and temperature shifts. Proteomic approaches using label-free quantification can complement transcriptional analysis, revealing post-transcriptional regulation mechanisms as demonstrated in studies identifying 2,289 B. abortus proteins under various stress conditions . A comprehensive experimental design would incorporate both single-stress and multi-stress conditions, as multi-stress environments more accurately reflect in vivo conditions and resulted in the lowest bacterial survival rates in previous studies . Changes in nuoK expression under stress may indicate its importance in adaptation to the intracellular niche and potential value as a vaccine target.

What are the key considerations for designing site-directed mutagenesis studies targeting nuoK?

Site-directed mutagenesis studies targeting NADH-quinone oxidoreductase subunit K require careful consideration of protein structure, function, and experimental validation approaches. Sequence alignment with nuoK homologs from related species can identify conserved residues likely critical for function, particularly those in transmembrane domains or at subunit interfaces within the complex. Computational structural modeling, ideally based on crystal structures of homologous proteins, can predict functional domains and guide selection of mutation targets. Key residues to consider include those involved in proton translocation, quinone binding, and interactions with adjacent subunits in the respiratory complex. When designing mutations, researchers should create a panel of variant types including conservative substitutions (maintaining similar physicochemical properties), non-conservative changes, and deletions of functional motifs. Experimental validation must assess both protein expression/stability (using Western blotting and thermal shift assays) and functional consequences (using enzyme activity assays and growth phenotyping under various stress conditions). Introduction of mutations into the chromosomal nuoK gene using allelic exchange techniques allows assessment of phenotypic effects in the native cellular context, complemented by trans-complementation studies to confirm mutation-specific effects. The extensive proteomic analysis techniques demonstrated for B. abortus, which have identified 74.5% of the predicted proteome, provide valuable tools for assessing the broader impacts of nuoK mutations on the bacterial proteome .

How can structural analysis of nuoK inform vaccine development strategies?

Structural analysis of NADH-quinone oxidoreductase subunit K provides critical insights that can accelerate vaccine development by identifying immunogenic epitopes, understanding protein-antibody interactions, and optimizing antigen design. X-ray crystallography or cryo-electron microscopy of purified nuoK, either alone or as part of the complete NADH-quinone oxidoreductase complex, can reveal surface-exposed regions likely to be recognized by the immune system. In the absence of crystal structures, homology modeling based on related bacterial respiratory complexes provides a starting point for epitope prediction. B-cell epitope prediction algorithms can identify linear and conformational epitopes on nuoK, with experimental validation through epitope mapping using synthetic peptide arrays and monoclonal antibodies. T-cell epitope prediction tools focusing on MHC class I and II binding can complement B-cell epitope analysis, as robust T-cell responses are essential for protection against intracellular pathogens like Brucella. Studies with recombinant Ndk from B. abortus have demonstrated the importance of balanced immune responses, showing elevated IgG2a compared to IgG1 (titers of 5.2 and 4.8, respectively) and strong induction of IFN-γ and proinflammatory cytokines . Structure-guided antigen design may involve creating chimeric constructs that present multiple epitopes from nuoK or combining nuoK epitopes with those from other protective antigens to generate multivalent vaccines. Stability studies of purified nuoK under various formulation conditions can guide development of vaccine preparations that maintain epitope integrity during storage and administration.

What laboratory biosafety practices are required for work with recombinant B. abortus proteins?

Research involving Brucella abortus and its recombinant proteins requires strict adherence to biosafety protocols due to the significant risk of laboratory-acquired infections. B. abortus has been responsible for numerous laboratory-acquired infections, necessitating Biosafety Level 3 (BSL-3) practices for work with viable organisms . For recombinant proteins, risk assessment should consider protein function, potential toxicity, and absence of infectious material. All culture work with viable B. abortus must be performed in a Class II Biological Safety Cabinet with proper personal protective equipment including gloves, laboratory coat, and eye protection . When handling suspicious colonies or positive cultures, plates should be taped shut and all testing performed only in the Biological Safety Cabinet . Centrifugation procedures should employ sealed rotors or safety cups to prevent aerosol generation. Laboratory workers should receive appropriate training and medical surveillance, including baseline serology and consideration of vaccination if available. Waste decontamination protocols must be strictly followed, with all materials being autoclaved or chemically disinfected before disposal. While purified recombinant proteins like nuoK may not require full BSL-3 containment if demonstrated to be free of viable bacteria, prudent practices including dedicated equipment, controlled access, and proper decontamination should still be maintained to prevent cross-contamination or accidental exposure.

What are the most effective methods for assessing immune responses to nuoK in animal models?

Comprehensive assessment of immune responses to NADH-quinone oxidoreductase subunit K requires evaluation of both humoral and cell-mediated immunity using complementary techniques. For humoral immunity, enzyme-linked immunosorbent assay (ELISA) represents the primary method for measuring antibody titers, with particular attention to IgG subclasses; studies with recombinant Ndk from B. abortus demonstrated higher IgG2a compared to IgG1 titers (5.2 versus 4.8), indicating a Th1-biased response beneficial for controlling intracellular pathogens . Western blotting provides qualitative confirmation of antibody specificity, while neutralization assays may assess functional antibody activity if relevant to nuoK. Cell-mediated immunity evaluation should focus on IFN-γ production through ELISPOT assays, intracellular cytokine staining, and quantification in culture supernatants by ELISA, as IFN-γ has been identified as crucial for Brucella control . Multiplex cytokine analysis should include proinflammatory cytokines (TNF, MCP1, IL-6) and regulatory cytokines (IL-10), providing a comprehensive profile of the immune response . Lymphocyte proliferation assays using tritiated thymidine incorporation or CFSE dilution can measure antigen-specific T-cell expansion upon restimulation. For challenge studies, bacterial burden in the spleen serves as the definitive measure of protection, with significantly lower spleen proliferation and bacterial burden observed in mice effectively protected against virulent B. abortus challenge . These methods should be applied at multiple timepoints to evaluate both primary response development and long-term immunological memory.

Table 1: Comparison of Immune Parameters Between nuoK-Immunized and Control Mice (Hypothetical Data Based on Similar Brucella Antigen Studies)

Immune ParameternuoK-Immunized MiceControl MiceStatistical Significance
IgG2a Titer5.1 ± 0.42.3 ± 0.3p < 0.01
IgG1 Titer4.7 ± 0.32.5 ± 0.2p < 0.01
IFN-γ (pg/ml)1450 ± 120320 ± 80p < 0.001
TNF (pg/ml)780 ± 90250 ± 60p < 0.01
IL-6 (pg/ml)650 ± 70180 ± 40p < 0.01
MCP1 (pg/ml)950 ± 110280 ± 50p < 0.001
IL-10 (pg/ml)180 ± 40150 ± 30p > 0.05
Spleen Weight (mg)140 ± 15210 ± 25p < 0.01
Log10 CFU in Spleen3.5 ± 0.45.8 ± 0.5p < 0.001

How can transcriptomics complement proteomic analyses of nuoK expression under stress?

Integrating transcriptomic and proteomic analyses provides a comprehensive understanding of NADH-quinone oxidoreductase subunit K regulation under various stress conditions relevant to host infection. RNA sequencing (RNA-Seq) offers unbiased, genome-wide transcriptional profiling with high sensitivity for detecting differential expression of nuoK and related genes under stress conditions such as oxidative stress, nutrient limitation, and acidic pH. Quantitative reverse transcription PCR (RT-qPCR) provides targeted validation of RNA-Seq findings with greater dynamic range and precision for measuring nuoK transcript levels. Time-course experiments capturing both early (minutes to hours) and late (hours to days) responses can distinguish between immediate transcriptional regulation and adaptive responses, potentially revealing regulatory networks controlling nuoK expression. Proteomic approaches similar to those used in comprehensive B. abortus studies, which quantified 2,272 proteins under various stress conditions, can determine whether transcriptional changes translate to altered protein levels . Integration of transcriptomic and proteomic datasets may reveal post-transcriptional regulation mechanisms, with discordance between transcript and protein levels suggesting involvement of regulatory RNAs or altered protein stability. Pathway analysis incorporating both transcriptomic and proteomic data can identify coordinated regulation of respiratory chain components and related metabolic pathways under stress. This multi-omics approach not only characterizes nuoK regulation but also places it within the broader context of B. abortus adaptation to the intracellular environment, potentially revealing new therapeutic targets or vaccine candidates.

What are common challenges in expressing and purifying recombinant nuoK and how can they be overcome?

Expressing and purifying recombinant NADH-quinone oxidoreductase subunit K presents several challenges due to its nature as a membrane protein with multiple transmembrane domains. Low expression levels frequently occur with membrane proteins, requiring optimization through testing multiple expression systems, including E. coli strains specifically designed for membrane protein expression (C41, C43) or alternative hosts like yeast or insect cells. Protein toxicity to host cells can be addressed by using tightly controlled inducible promoters, reduced incubation temperatures (16-25°C), and lower inducer concentrations to slow expression rate. Inclusion body formation, common with hydrophobic proteins, may be mitigated by fusion to solubility-enhancing tags such as MBP or SUMO, similar to approaches used successfully with other Brucella proteins . During purification, protein aggregation can be prevented by including appropriate detergents throughout all purification steps, with screening of detergent types (DDM, LMNG, digitonin) and concentrations crucial for maintaining protein stability. Protein instability during purification requires optimized buffer conditions, including appropriate pH, salt concentration, and stabilizing additives such as glycerol or specific lipids. Low purification yields, a common issue with membrane proteins, may be improved by scale-up of culture volume, optimization of extraction conditions, and efficient tag cleavage methods if applicable. When standard approaches fail, alternative strategies include cell-free protein synthesis systems specifically optimized for membrane proteins or extraction as peptide fragments representing specific domains for structural or immunological studies.

How can researchers troubleshoot inconsistent immune responses to nuoK-based vaccine candidates?

Inconsistent immune responses to NADH-quinone oxidoreductase subunit K-based vaccine candidates can stem from multiple factors requiring systematic troubleshooting approaches. Protein quality issues are primary concerns, necessitating rigorous quality control including SDS-PAGE for purity assessment, circular dichroism for conformational analysis, and mass spectrometry for identity confirmation. Endotoxin contamination, particularly in proteins expressed in E. coli, can be detected using the Limulus amebocyte lysate (LAL) assay and removed through specialized chromatography techniques or commercial endotoxin removal kits. Adjuvant selection significantly impacts immune response quality, requiring comparative studies of traditional adjuvants (alum, Freund's) versus newer options (liposomes, immune stimulating complexes) as demonstrated in studies with other Brucella antigens showing distinctive IgG subclass profiles . Dosage optimization through dose-response experiments can identify the minimum effective dose, with suboptimal dosing potentially resulting in tolerance rather than protective immunity. Route of administration influences both the magnitude and type of immune response, with subcutaneous, intradermal, and intraperitoneal routes typically favored for experimental vaccines. Variability between animal subjects can be addressed by increasing sample sizes, ensuring genetic consistency (inbred strains), and controlling for age, sex, and microbiome factors. Timing of assessments is critical for capturing peak responses, particularly for parameters with distinct kinetics such as antibody production versus T-cell responses. Comprehensive immune profiling including both antibody measurements and cellular responses (particularly IFN-γ production) provides a more complete picture of vaccine-induced immunity, allowing identification of specific deficiencies in the immune response.

What controls are essential for validating specificity in nuoK expression and localization studies?

Rigorous controls are essential for ensuring specificity and reliability in studies examining NADH-quinone oxidoreductase subunit K expression and subcellular localization. For Western blot analysis, positive controls should include purified recombinant nuoK protein while negative controls should utilize samples from nuoK knockout mutants or pre-immune serum for antibody specificity validation. Antibody validation requires demonstration of specificity through multiple techniques, including Western blotting against recombinant protein, immunoprecipitation followed by mass spectrometry confirmation, and reduced or absent signal in nuoK knockout or knockdown strains. For immunofluorescence microscopy, competitive inhibition with excess recombinant protein can confirm antibody specificity, while co-localization with known respiratory complex markers provides functional validation of localization patterns. When using epitope-tagged constructs, parallel analysis of multiple tag types (HA, FLAG, His) at different positions (N-terminal, C-terminal) helps ensure tag position does not interfere with localization signals. Functional complementation of nuoK knockout mutants with tagged constructs confirms that tagging does not disrupt protein function. For quantitative PCR analysis of nuoK expression, multiple reference genes should be validated for stability under experimental conditions, with primer specificity confirmed through melt curve analysis, sequencing of amplicons, and absence of amplification in nuoK knockout controls. The comprehensive proteomic approach demonstrated in B. abortus studies, which identified over 74% of the predicted proteome, provides an excellent framework for validating protein identification and quantification methods .

What emerging technologies could advance nuoK-based vaccine development against brucellosis?

Emerging technologies offer promising avenues to overcome current limitations in NADH-quinone oxidoreductase subunit K-based vaccine development against brucellosis. mRNA vaccine platforms, which have demonstrated success with COVID-19 vaccines, could be adapted for nuoK delivery, potentially inducing both humoral and cell-mediated immunity without risks associated with live attenuated Brucella strains. Nanomaterial-based delivery systems including liposomes, polymeric nanoparticles, and self-assembling protein nanoparticles can enhance antigen stability and presentation to immune cells, potentially increasing immunogenicity of nuoK-derived epitopes. Structural vaccinology approaches utilizing high-resolution techniques like cryo-electron microscopy could identify immunodominant epitopes within nuoK, enabling rational design of epitope-focused vaccines that maximize protective immunity while minimizing reactogenic components. CRISPR-Cas9 technology facilitates precise genetic manipulation of Brucella strains, potentially creating novel live attenuated vaccines with specific modifications to nuoK or related genes, building upon the established effectiveness of attenuated strains like B. abortus S19 . Systems vaccinology incorporating transcriptomic, proteomic, and metabolomic analyses could identify molecular signatures of protective immunity against Brucella, guiding formulation of nuoK-based vaccines optimized for inducing these signatures. Reverse vaccinology approaches analyzing the complete B. abortus genome and proteome, similar to comprehensive proteomic studies that identified 74.5% of the predicted proteome, could identify additional antigens that synergize with nuoK for enhanced protection . These emerging technologies, combined with established methods for assessing immune responses to Brucella antigens, provide a robust framework for next-generation vaccine development against this significant zoonotic pathogen.

How might nuoK research contribute to novel antibiotic development strategies?

Research on NADH-quinone oxidoreductase subunit K offers promising avenues for novel antibiotic development targeting Brucella abortus and potentially other bacterial pathogens. Structure-based drug design focusing on nuoK or its binding interfaces within the respiratory complex could yield inhibitors that specifically disrupt electron transport and energy generation in Brucella. High-throughput screening of chemical libraries against purified nuoK or reconstituted respiratory complexes can identify lead compounds for further optimization, with assays measuring electron transfer activity providing functional readouts of inhibition. Fragment-based drug discovery approaches could identify small molecules binding to critical sites on nuoK, which can then be elaborated into more potent inhibitors with optimized pharmacokinetic properties. Proteomics studies revealing differential expression of respiratory chain components under stress conditions, similar to those identifying 2,272 B. abortus proteins under various stresses, can guide selection of conditions for antibiotic susceptibility testing . Allosteric inhibitors targeting regulatory sites rather than active sites may provide greater selectivity and reduced resistance development compared to competitive inhibitors. Combination approaches targeting multiple components of the electron transport chain simultaneously could enhance efficacy and reduce resistance development, particularly important for treating persistent Brucella infections that may survive within macrophages under stress conditions. Species-specific structural differences in nuoK between bacterial pathogens and mammalian hosts could be exploited to develop selective inhibitors with minimal host toxicity. Target validation through genetic approaches, including conditional knockdown of nuoK expression, would confirm the essentiality of this target for bacterial survival under relevant physiological conditions.

Table 2: Potential Drug Development Strategies Targeting nuoK and Expected Outcomes

Targeting StrategyMechanism of ActionExpected OutcomeDevelopment Complexity
Active Site InhibitionBlocks electron transferRapid bactericidal effectModerate
Protein-Protein Interface DisruptionPrevents complex assemblyBacteriostatic effectHigh
Allosteric ModulationAlters protein conformationReduced efficiencyModerate
Membrane Anchoring DisruptionPrevents proper localizationComplex instabilityHigh
Dual-Target InhibitionSimultaneous inhibition of multiple componentsSynergistic effectVery High

What interdisciplinary approaches could enhance understanding of nuoK's role in Brucella pathogenesis?

Interdisciplinary approaches combining diverse scientific methodologies offer powerful strategies for elucidating NADH-quinone oxidoreductase subunit K's role in Brucella pathogenesis. Structural biology techniques including X-ray crystallography, cryo-electron microscopy, and nuclear magnetic resonance spectroscopy can reveal nuoK's three-dimensional structure and interactions within the respiratory complex, informing both functional studies and drug design efforts. Computational biology approaches such as molecular dynamics simulations can model nuoK behavior under various conditions, predicting conformational changes and identifying potential druggable sites that may not be apparent from static structures. Systems biology integration of transcriptomic, proteomic, and metabolomic data, building upon comprehensive proteomic studies that identified 74.5% of the B. abortus proteome, can place nuoK within broader cellular networks and identify unexpected functional relationships . Advanced microscopy techniques including super-resolution microscopy and correlative light and electron microscopy can visualize nuoK localization and dynamics during host cell infection, potentially revealing spatiotemporal regulation of respiratory complexes. Host-pathogen interaction studies using primary cell models and transgenic mice can assess how nuoK contributes to immune evasion and intracellular survival, complementing traditional bacterial genetic approaches. Single-cell technologies applied to infected host cells could reveal heterogeneity in bacterial responses and identify subpopulations with distinct nuoK expression patterns or metabolic states. Evolutionary approaches comparing nuoK sequences and functions across Brucella species and biovars may reveal adaptive changes related to host specificity or virulence. These interdisciplinary approaches, when combined with traditional microbiology and immunology methods, provide a comprehensive framework for understanding nuoK's multifaceted roles in Brucella pathogenesis and identifying new intervention strategies.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.