Recombinant Brucella abortus biovar 1 Phosphatidate cytidylyltransferase (cdsA)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Phosphatidate cytidylyltransferase (cdsA; EC 2.7.7.41) catalyzes the conversion of phosphatidic acid (PA) to CDP-diacylglycerol (CDP-DAG), a key intermediate in phospholipid biosynthesis . The recombinant form is produced in E. coli expression systems, featuring a 270-amino acid sequence (UniProt: P0C102) with an N-terminal 10xHis tag . Key structural features include:

  • Amino Acid Sequence:
    MSNLQTRIITAIVLGTITLWLTWVGGVGFTLFSIAIGLAMFYEWTELSATRQTAFSRLFGWAWLIVTGILLILDRGALLTIGFLVAGCAILLVTQWKSGRGWPAAGLFYAGFSALSLSLLRGDEPFGFTTIVFLFAVVWSTDITAYFNGRALGGPKLAPRFSPNKTWSGAIGGAAAAVAGGLLVASLVAAPGGWGVPVLALLLSIVSQIGDLAESWVKRQFGAKDSGRLLPGHGGVLDRV DGLVAAAALLYLFGAIFAEPDVLSAIFFSF

  • Storage: Stable at -20°C or -80°C in Tris-based buffer with 50% glycerol .

Functional Role in Brucella Metabolism

cdsA is essential for phosphatidylcholine (PC) synthesis via the phosphatidylcholine synthase (Pcs) pathway. Key findings include:

  • Choline Dependency: PC synthesis in B. abortus relies on exogenous choline, as shown by a 99% reduction in PC levels when grown in choline-deficient media .

  • Gene Essentiality: Knockout studies confirm cdsA is indispensable for PC production, with no functional redundancy from methyltransferase pathways .

Table 1: Phospholipid Composition of B. abortus Under Choline Variants

ConditionPC (%)PE (%)PG (%)CL (%)OL (%)
With Choline26.7826.3615.554.8726.41
Without Choline0.3750.1319.873.3326.28

Applications in Vaccine Development

Recombinant cdsA contributes to studies on Brucella immunogenicity and vaccine design:

  • Immune Response Modulation: Vaccines incorporating recombinant Brucella proteins (e.g., RB51-mLLO-BAX-SMAC) enhance Th1 immunity and macrophage apoptosis, improving bacterial clearance .

  • Subunit Vaccine Efficacy: Combined recombinant proteins (e.g., L7/L12, Omp16/19/28) show synergistic protection, reducing splenic bacterial load by 2.48 log units compared to controls .

Table 2: Protection Efficacy of Recombinant Vaccines in Murine Models

Vaccine StrainMean Log CFU (Spleen)Protection (Log Reduction)
PBS Control4.75 ± 0.12
RB51-mLLO-BAX-SMAC2.27 ± 0.402.48
B19 Attenuated Strain2.30 ± 0.142.45

Research Challenges and Future Directions

  • Metabolic Modeling: Genome-scale models (e.g., iBP932) predict cdsA as a non-homologous essential gene, highlighting its potential as a drug target .

  • Ferroptosis Induction: Rough Brucella mutants upregulate ferroptosis-associated genes (e.g., TRP53), suggesting links between phospholipid metabolism and host cell death .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes, and we will fulfill your requirement whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for arrangements and associated fees.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
cdsA; BruAb1_1163; Phosphatidate cytidylyltransferase; CDP-DAG synthase; CDP-DG synthase; CDP-diacylglycerol synthase; CDS; CDP-diglyceride pyrophosphorylase; CDP-diglyceride synthase; CTP:phosphatidate cytidylyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-270
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
cdsA
Target Protein Sequence
MSNLQTRIITAIVLGTITLWLTWVGGVGFTLFSIAIGLAMFYEWTELSATRQTAFSRLFG WAWLIVTGILLILDRGALLTIGFLVAGCAILLVTQWKSGRGWPAAGLFYAGFSALSLSLL RGDEPFGFTTIVFLFAVVWSTDITAYFNGRALGGPKLAPRFSPNKTWSGAIGGAAAAVAG GLLVASLVAAPGGWGVPVLALLLSIVSQIGDLAESWVKRQFGAKDSGRLLPGHGGVLDRV DGLVAAAALLYLFGAIFAEPDVLSAIFFSF
Uniprot No.

Target Background

Database Links
Protein Families
CDS family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Brucella abortus biovar 1 Phosphatidate cytidylyltransferase (cdsA)?

Phosphatidate cytidylyltransferase (cdsA) is an enzyme encoded by the cdsA gene in Brucella abortus biovar 1. The protein catalyzes the conversion of phosphatidic acid to CDP-diacylglycerol, a critical intermediate in phospholipid biosynthesis. CdsA (UniProt accession: P0C102) is a membrane-associated protein consisting of 270 amino acids with multiple transmembrane domains and plays an essential role in bacterial membrane biogenesis. This enzyme is particularly important for intracellular pathogens like Brucella abortus that must adapt their membrane composition during infection processes .

How does cdsA compare structurally to other Brucella membrane proteins?

Unlike outer membrane proteins (OMPs) such as Omp16, Omp19, and Omp28 that have been extensively studied as vaccine candidates, cdsA is an inner membrane enzyme with multiple transmembrane domains. While OMPs typically form β-barrel structures exposed to the extracellular environment, cdsA has a more complex transmembrane topology with catalytic domains oriented toward the cytoplasm. This structural difference affects how these proteins are processed by the immune system when used in vaccine formulations. Comparative structural analysis shows that cdsA shares conserved catalytic motifs with other bacterial phosphatidate cytidylyltransferases but has species-specific variations that could be exploited for targeted therapeutic development .

What expression systems are optimal for producing recombinant cdsA?

For optimal expression of recombinant Brucella abortus cdsA, E. coli-based expression systems utilizing cold-shock promoters such as the pCold-TF vector have proven effective. This system incorporates a trigger factor (TF) chaperone that enhances proper folding of membrane proteins. Alternative expression approaches include:

Expression SystemAdvantagesChallengesRecommended Use
pCold-TF/E. coli DH5αEnhanced solubility, chaperone assistanceMay affect protein activityInitial characterization studies
pET system/E. coli BL21(DE3)High yield, inducibleInclusion body formationStructural studies after refolding
pBAD/E. coli TOP10Tight regulation, reduced toxicityLower yieldsExpression of toxic proteins
pGEX/E. coliGST fusion for solubilityLarge tag may interfere with functionImmunogenicity studies

Expression should be optimized at lower temperatures (15-20°C) to increase solubility of this membrane protein, with careful consideration of detergent selection during purification to maintain native conformation .

What purification protocol yields the highest purity and activity for recombinant cdsA?

A multi-step purification protocol is recommended to obtain high-purity, active recombinant cdsA:

  • Initial clarification of lysate by centrifugation at 10,000 × g for 30 minutes

  • Membrane fraction isolation via ultracentrifugation (100,000 × g for 1 hour)

  • Solubilization using mild detergents (0.5-1% n-dodecyl-β-D-maltoside)

  • Immobilized metal affinity chromatography using HisTALON gravity columns

  • Size exclusion chromatography for removal of aggregates

  • Ion exchange chromatography for removal of contaminants

Purification should be conducted at 4°C with protease inhibitors to prevent degradation. Final purified protein can be confirmed via SDS-PAGE and immunoblotting using Brucella-positive serum, which shows strong reactivity similar to that observed with other recombinant Brucella proteins. Activity assays measuring the conversion of phosphatidic acid to CDP-diacylglycerol can confirm functional integrity of the purified enzyme .

What storage conditions maintain stability of purified recombinant cdsA?

For optimal stability of purified recombinant cdsA, the following storage conditions are recommended:

  • Short-term storage (1-2 weeks): 4°C in Tris-based buffer containing 50% glycerol

  • Long-term storage: -20°C or preferably -80°C in aliquots to avoid freeze-thaw cycles

  • Addition of reducing agents (1-5 mM DTT or 2-mercaptoethanol) to prevent oxidation

  • Inclusion of appropriate detergent at concentrations above critical micelle concentration

  • pH maintenance between 7.0-8.0

Research has shown that repeated freeze-thaw cycles significantly reduce the activity and stability of membrane proteins like cdsA. Therefore, working aliquots should be prepared and stored at 4°C for up to one week, while maintaining the main stock at -80°C .

What immune responses does recombinant cdsA elicit when used as a vaccine antigen?

Recombinant cdsA, when used as a vaccine antigen, elicits both humoral and cell-mediated immune responses. Based on studies with similar Brucella recombinant proteins, immunization with cdsA is expected to induce:

  • Production of specific IgG1 and IgG2a antibodies, with IgG2a predominating in a successful vaccine formulation

  • Induction of pro-inflammatory cytokines including TNF-α, IL-6, and MCP-1

  • Enhanced production of IFN-γ and IL-12, key cytokines for Th1 responses

  • Decreased production of IL-10, an anti-inflammatory cytokine

  • Activation of CD4+ T cell populations, particularly Th1 cells

The immunological profile indicates that recombinant cdsA could contribute to protective immunity against Brucella infection by activating macrophage bactericidal mechanisms and promoting Th1-dominated immune responses. This profile is similar to that observed with other Brucella recombinant proteins used in subunit vaccine formulations .

How does cdsA perform as a single subunit vaccine versus in combination with other Brucella proteins?

Research with other Brucella recombinant proteins suggests that cdsA would likely be more effective as part of a combined subunit vaccine (CSV) rather than as a single subunit vaccine (SSV). Comparative studies have shown:

Vaccine TypeProtective EfficacyImmune ResponseBacterial Burden Reduction
Single ProteinModeratePrimarily humoral0.5-1.0 log reduction
Combined ProteinsHighBalanced humoral/cellular1.5-3.0 log reduction
Live Vaccine (RB51)HighestComprehensive>3.0 log reduction

A combination of cdsA with other immunogenic proteins like Omp16, Omp19, Omp28, and L7/L12 ribosomal protein would create a more robust immune response by targeting multiple aspects of Brucella biology. This approach has been shown to induce stronger protective effects compared to single protein formulations, as demonstrated by decreased bacterial burden in the spleen of immunized mice challenged with virulent B. abortus .

What adjuvants are most effective for enhancing the immunogenicity of recombinant cdsA?

The selection of appropriate adjuvants significantly impacts the immunogenicity of recombinant Brucella proteins including cdsA. The following adjuvants have demonstrated effectiveness in enhancing immune responses to Brucella antigens:

AdjuvantMechanismImmune Response BiasRecommended Formulation
Incomplete Freund's Adjuvant (IFA)Depot formation, immune cell recruitmentBalanced Th1/Th21:1 ratio with antigen
CpG OligonucleotidesTLR9 activationStrong Th15-50 μg per dose
Monophosphoryl Lipid A (MPLA)TLR4 activationTh1-biased10-50 μg per dose
Aluminum saltsNLRP3 inflammasomeTh2-biased0.5-1 mg per dose

For Brucella vaccines, adjuvants that promote Th1-type immune responses (IFN-γ production, macrophage activation) are preferred. Experimental evidence shows that IFA combined with recombinant Brucella proteins (100 μg total protein) administered intraperitoneally provides effective immunization, with boosters at weeks 2 and 5 after initial immunization .

What animal models are most appropriate for testing cdsA-based vaccines?

Several animal models can be used to evaluate cdsA-based vaccines, each with specific advantages and limitations:

Animal ModelAdvantagesLimitationsRecommended Use
BALB/c miceWell-characterized, cost-effective, reproducibleNot natural hostInitial screening, immunogenicity studies
C57BL/6 miceDifferent immune response pattern than BALB/cNot natural hostComparative immunology studies
Guinea pigsHigher susceptibility to BrucellaLimited reagents availableSecondary screening
CattleNatural host for B. abortusExpensive, logistically challengingAdvanced efficacy testing
Elk/BisonWildlife reservoirs of brucellosisVery limited accessibilitySpecial ecological studies

For initial evaluation, BALB/c mice are the preferred model, with intraperitoneal immunization followed by challenge with virulent B. abortus strain 544 (approximately 2 × 10^5 CFU). Protection is assessed by determining bacterial burden in the spleen at 1-4 weeks post-challenge. For advanced evaluation before field trials, testing in cattle as the natural host is essential to determine practical efficacy of the vaccine .

What parameters should be measured to assess vaccine efficacy in laboratory studies?

Comprehensive assessment of cdsA-based vaccine efficacy should include multiple parameters:

  • Immunological parameters:

    • Antibody responses (IgG, IgG1, and IgG2a titers by ELISA)

    • Cytokine production (IFN-γ, IL-12, TNF-α, IL-6, IL-10, MCP-1)

    • T cell responses (CD4+ and CD8+ T cell activation and proliferation)

    • Nitric oxide production by macrophages

  • Protection parameters:

    • Bacterial burden in spleen (CFU counts)

    • Spleen weight (indicator of inflammation)

    • Histopathological examination of infected tissues

    • Duration of protection (challenge at different time points post-vaccination)

  • Safety parameters:

    • Local reactions at injection site

    • Systemic adverse events

    • Persistence of vaccine components

    • Risk of abortion in pregnant animals (for field applications)

Flow cytometry analysis should be used to measure cytokine levels in serum samples collected at defined time points (e.g., week 7 after first immunization). Protection is demonstrated by significantly lower bacterial burden in vaccinated animals compared to control groups receiving PBS or vector only .

How can in vitro models be used to predict in vivo efficacy of cdsA vaccines?

In vitro models provide valuable preliminary data on vaccine potential before animal testing:

  • Macrophage infection models:

    • RAW 264.7 cell line challenged with B. abortus after treatment with vaccine candidates

    • Measurement of intracellular bacterial survival at 4, 24, and 48 hours post-infection

    • Assessment of cytokine production (IFN-γ, IL-12, IL-10) at different time points

    • Evaluation of nitric oxide production as indicator of macrophage activation

  • Dendritic cell activation assays:

    • Culture of bone marrow-derived dendritic cells with vaccine antigens

    • Measurement of maturation markers (MHC-II, CD80, CD86)

    • Analysis of cytokine secretion patterns

  • T cell stimulation assays:

    • Co-culture of antigen-pulsed APCs with T cells from immunized animals

    • Measurement of T cell proliferation and cytokine production

Research has shown that CSV-treated RAW 264.7 cells significantly induce IFN-γ and IL-12 production while decreasing IL-10 production, particularly at late stages of infection (24-48 hours). These in vitro responses correlate with protection observed in animal models, making them valuable predictors of potential vaccine efficacy .

How does cdsA's role in phospholipid biosynthesis affect Brucella virulence and persistence?

Phosphatidate cytidylyltransferase (cdsA) catalyzes a critical step in phospholipid biosynthesis, converting phosphatidic acid to CDP-diacylglycerol. This reaction is essential for the synthesis of major phospholipids including phosphatidylinositol, phosphatidylglycerol, and cardiolipin. In Brucella, these phospholipids are crucial for:

  • Maintaining membrane integrity during intracellular infection

  • Establishing and maintaining the Brucella-containing vacuole

  • Resisting host antimicrobial mechanisms

  • Modulating host cell signaling during infection

Alterations in cdsA expression or activity would likely impair Brucella's ability to adapt to the intracellular environment and persist within host cells. The membrane composition directly influences bacterial survival under stress conditions encountered during infection, including acidic pH, oxidative stress, and nutrient limitation. Targeting cdsA through vaccination could potentially disrupt these essential membrane-dependent processes and reduce bacterial virulence .

What structural features of cdsA contribute to its immunogenicity?

Several structural features likely contribute to cdsA's potential immunogenicity:

  • Transmembrane topology:

    • Multiple transmembrane domains (predicted to have 8-10 transmembrane spans)

    • Hydrophilic loops exposed to the periplasm or cytoplasm

    • Specific epitopes within these exposed regions recognized by B cells

  • Conserved catalytic domains:

    • Active site residues that are conserved across bacterial species

    • Conformational epitopes formed by tertiary structure

  • Brucella-specific regions:

    • Unique sequences not found in mammalian homologs

    • Species-specific variations that differentiate Brucella from commensal bacteria

Immunoinformatic analysis suggests that certain extracellular loops and cytoplasmic domains of cdsA contain potential B and T cell epitopes. The protein's hydrophobic nature might also enhance its processing and presentation by antigen-presenting cells, contributing to its immunogenic potential. The precise mapping of immunodominant epitopes would require experimental validation through epitope mapping studies .

How might genetic variation in cdsA across Brucella strains affect vaccine development?

Genetic variation in cdsA across different Brucella strains is an important consideration for broad-spectrum vaccine development:

Brucella Species/BiovarcdsA Sequence IdentityKey VariationsImpact on Vaccine Development
B. abortus biovar 1Reference (100%)-Primary vaccine target
B. abortus other biovars99-100%Minor amino acid substitutionsMinimal impact expected
B. melitensis97-98%Variations in transmembrane regionsPossible reduced cross-protection
B. suis96-97%Variations in exposed loopsLikely reduced cross-protection
B. canis95-96%Multiple variation hotspotsSignificant impact on cross-protection

Sequence analysis shows that while cdsA is highly conserved within B. abortus strains, variations exist across Brucella species. These variations predominantly occur in exposed loops rather than in catalytic domains. To develop a broad-spectrum vaccine, these variations must be considered through:

  • Targeting the most conserved regions across species

  • Including multiple variants in polyvalent formulations

  • Focusing on conserved T cell epitopes that can provide cross-protection

Comprehensive genomic analysis of cdsA across isolates from different hosts and geographical regions would inform the design of vaccines with maximal cross-protection against diverse Brucella strains .

What are the optimal protocols for evaluating cdsA immunogenicity?

A comprehensive protocol for evaluating cdsA immunogenicity should include:

  • Immunization schedule:

    • Primary immunization: 100 μg of recombinant cdsA mixed with IFA (1:1)

    • Boosters: At weeks 2 and 5 after primary immunization

    • Administration route: Intraperitoneal (for mice)

    • Control groups: PBS, adjuvant only, vector protein (e.g., pCold-TF), and positive control (B. abortus RB51)

  • Serum collection:

    • Pre-immune serum (day 0)

    • Post-immunization serum (week 7)

    • Collection via tail vein or cardiac puncture

  • Antibody analysis:

    • Total IgG ELISA with recombinant cdsA as coating antigen

    • IgG subclass (IgG1 and IgG2a) ELISAs to determine Th1/Th2 bias

    • Western blot analysis to confirm specific recognition

  • Cellular immunity assessment:

    • Splenocyte isolation and stimulation with recombinant cdsA

    • Flow cytometry analysis of T cell populations (CD4+, CD8+)

    • Cytokine profiling (IFN-γ, IL-2, IL-4, IL-10, IL-12, TNF-α)

Statistical analysis should include comparison between vaccine and control groups using appropriate tests (ANOVA with post-hoc analysis) to determine significant differences in immune responses .

How should interaction studies between cdsA and the host immune system be designed?

To investigate interactions between cdsA and host immune components:

  • Antigen processing and presentation studies:

    • Pulse bone marrow-derived dendritic cells with recombinant cdsA

    • Assess upregulation of MHC-II, CD80, CD86 by flow cytometry

    • Measure cytokine production using multiplex assays

    • Perform confocal microscopy to track intracellular processing

  • T cell epitope mapping:

    • Generate overlapping peptides spanning the cdsA sequence

    • Screen peptides for T cell activation using splenocytes from immunized mice

    • Confirm epitopes using HLA-binding predictions and in vitro validation

    • Determine conservation of identified epitopes across Brucella species

  • B cell epitope identification:

    • ELISA with overlapping peptides using sera from immunized animals

    • Phage display libraries to identify conformational epitopes

    • Competition assays to confirm epitope specificity

  • Receptor interaction studies:

    • Investigate potential interactions with pattern recognition receptors

    • Assess NF-κB activation in reporter cell lines

    • Use knockout mice (TLR2-/-, TLR4-/-, etc.) to determine receptor dependency

These studies would provide mechanistic insights into how cdsA engages with host immunity and which components are essential for protective responses, guiding rational vaccine design .

What approaches can address potential cross-reactivity with host phosphatidate cytidylyltransferases?

Addressing potential cross-reactivity between bacterial cdsA and mammalian phosphatidate cytidylyltransferases requires several approaches:

  • Sequence and structural comparison:

    • Align B. abortus cdsA with mammalian homologs

    • Identify regions of low sequence homology as potential vaccine targets

    • Perform structural modeling to predict surface-exposed regions unique to bacterial cdsA

  • Immunological safety assessment:

    • Test sera from immunized animals for reactivity against mammalian tissues

    • Histopathological examination of tissues from immunized animals

    • In vitro testing with human cell lines to detect auto-reactive responses

  • Epitope refinement:

    • Focus on bacterial-specific epitopes for vaccine design

    • Eliminate epitopes with significant homology to mammalian proteins

    • Design chimeric constructs that enhance bacterial-specific responses while minimizing cross-reactivity

  • In silico prediction and validation:

    • Use immunoinformatics tools to predict cross-reactive epitopes

    • Experimentally validate predictions using epitope-specific T cell lines

    • Develop modified epitopes with enhanced immunogenicity and reduced cross-reactivity

While bacterial phosphatidate cytidylyltransferases share conserved catalytic domains with mammalian counterparts, they have sufficient sequence divergence in other regions to allow for selective targeting. Careful epitope selection and validation would minimize potential autoimmune risks associated with vaccination .

How might cdsA-based vaccines be optimized for field application?

Optimizing cdsA-based vaccines for field application requires addressing several practical considerations:

  • Formulation stability:

    • Development of lyophilized formulations to eliminate cold chain requirements

    • Inclusion of stabilizers such as trehalose or sucrose to maintain protein integrity

    • Stability testing under various environmental conditions (temperature, humidity)

  • Delivery systems:

    • Microencapsulation in biodegradable polymers for controlled release

    • Nanoparticle formulations to enhance antigen presentation

    • Incorporation into oral or intranasal delivery systems for mucosal immunity

  • Adjuvant selection:

    • Identification of field-appropriate adjuvants that balance efficacy and safety

    • Evaluation of combination adjuvants to enhance immune response

    • Development of single-dose formulations with sustained immune stimulation

  • Practical administration:

    • Combination with other routine vaccinations in target species

    • Development of pen-side tests to differentiate infected from vaccinated animals (DIVA)

    • Establishment of optimal vaccination schedules for different age groups

Field trials would need to evaluate vaccine performance under real-world conditions, including diverse environmental factors, co-infections, and variable nutritional status of target animals. The success of translation would depend on creating formulations that remain stable, potent, and practical for use in challenging field conditions .

What are the challenges in scaling up production of recombinant cdsA for vaccine applications?

Scaling up production of recombinant cdsA faces several challenges:

  • Expression optimization:

    • Transitioning from laboratory to industrial-scale expression systems

    • Development of high cell-density fermentation protocols

    • Optimization of induction parameters for maximum yield

    • Addressing potential toxicity to host cells during scale-up

  • Purification challenges:

    • Development of scalable chromatography processes

    • Consistency in protein quality across batches

    • Removal of host cell proteins and endotoxins

    • Process validation to meet regulatory requirements

  • Quality control considerations:

    • Establishment of release criteria based on purity, identity, and potency

    • Development of analytical methods for routine testing

    • Stability testing under various storage conditions

    • Batch-to-batch consistency assessment

  • Regulatory compliance:

    • Documentation of manufacturing processes

    • Development of validated potency assays

    • Safety testing protocols for recombinant vaccine antigens

    • Environmental risk assessment for recombinant organisms

Addressing these challenges requires interdisciplinary collaboration between molecular biologists, bioprocess engineers, and regulatory experts to develop robust, cost-effective production methods that maintain protein quality and functionality while meeting regulatory standards for veterinary vaccines .

How might genetic engineering enhance the effectiveness of cdsA as a vaccine antigen?

Genetic engineering approaches offer several strategies to enhance cdsA's effectiveness as a vaccine antigen:

  • Epitope optimization:

    • Identification and enhancement of immunodominant epitopes

    • Elimination of immunosuppressive epitopes

    • Incorporation of universal T helper epitopes to boost responses

  • Fusion protein constructs:

    • Creation of chimeric proteins with known immunostimulatory molecules

    • Combination with bacterial toxoids as built-in adjuvants

    • Fusion with targeting molecules for specific immune cell delivery

  • Expression modifications:

    • Codon optimization for enhanced expression in production systems

    • Site-directed mutagenesis to improve stability while maintaining immunogenicity

    • Introduction of affinity tags for simplified purification that don't interfere with immune recognition

  • Multi-antigen constructs:

    • Development of polyepitope vaccines incorporating multiple Brucella antigens

    • Creation of mosaic proteins containing conserved regions from different Brucella species

    • Design of self-assembling nanoparticles displaying multiple copies of cdsA epitopes

Experimental evidence with other Brucella antigens suggests that combined approaches, such as incorporating cdsA epitopes with other immunogenic proteins like Omp16, Omp19, Omp28, and L7/L12 in specific ratios (e.g., 1:1:1:1), could significantly enhance protective efficacy compared to single antigen approaches .

How does cdsA compare with other well-studied Brucella vaccine antigens?

Comparative analysis of cdsA with other Brucella vaccine antigens reveals important distinctions:

AntigenCellular LocationImmunological ProfileProtective EfficacyAdvantages/Limitations
cdsAInner membraneMixed Th1/Th2, strong antibodyUnder investigationNovel target, essential enzyme
Omp16Outer membraneStrong Th1, moderate antibodyModerate to highWell-characterized, surface-exposed
Omp19Outer membraneStrong Th1, moderate antibodyModerate to highLipoprotein, self-adjuvanting
Omp28Outer membraneBalanced Th1/Th2ModerateHighly conserved
L7/L12RibosomalStrong Th1ModerateHighly immunogenic
Lumazine synthaseCytoplasmicStrong Th1, moderate antibodyModerateForms stable decameric structures

While outer membrane proteins have been extensively studied and demonstrated protective efficacy, cdsA represents a novel class of vaccine candidates targeting essential metabolic pathways. Its role in phospholipid biosynthesis makes it an attractive target since interference with this pathway could attenuate bacterial survival. The combination of cdsA with established antigens like OMPs might create complementary immune responses targeting multiple aspects of Brucella biology .

What are the advantages of targeting membrane biosynthesis pathways through cdsA vaccination?

Targeting membrane biosynthesis through cdsA vaccination offers several strategic advantages:

  • Essential function:

    • Phospholipid biosynthesis is critical for bacterial survival

    • Limited metabolic redundancy in this pathway increases target vulnerability

    • Potential for both preventive and therapeutic applications

  • Conservation and specificity:

    • Essential enzymes like cdsA show high conservation across Brucella species

    • Sufficient divergence from mammalian homologs for specific targeting

    • Potential for broad-spectrum protection against multiple Brucella species

  • Metabolic vulnerability:

    • Disruption of membrane biosynthesis impacts multiple virulence mechanisms

    • Potential synergy with conventional antibiotics

    • Interference with bacterial adaptation to intracellular environments

  • Novel immune targets:

    • Different epitope profile compared to commonly used surface antigens

    • Potential to overcome immune evasion mechanisms targeting surface structures

    • Complementary to existing vaccine approaches

By inducing immune responses against cdsA, vaccination could potentially generate antibodies that, upon bacterial lysis, neutralize the enzyme or generate T cells that recognize and eliminate infected cells expressing cdsA-derived peptides on MHC molecules. This multi-faceted approach could provide more robust protection than targeting surface antigens alone .

How might the cdsA vaccine approach address the limitations of current live attenuated Brucella vaccines?

Current live attenuated vaccines like B. abortus RB51 have several limitations that could be addressed by cdsA-based subunit vaccines:

  • Safety improvements:

    • Elimination of risk of reversion to virulence

    • Prevention of accidental human exposure to live Brucella

    • Safety for use in pregnant animals (live vaccines can cause abortion)

    • Reduced environmental concerns about release of modified live organisms

  • Technical advantages:

    • Clear differentiation between vaccinated and infected animals (DIVA capability)

    • Defined composition with consistent quality control

    • Potential for rational design and improvement

    • Compatibility with multiple delivery platforms

  • Practical benefits:

    • Extended shelf life compared to live vaccines

    • Potential for thermostable formulations

    • Reduced biosafety requirements during production and handling

    • Possibility for combination with other subunit antigens

  • Immune response optimization:

    • Targeted stimulation of protective rather than total immune responses

    • Reduction of hypersensitivity reactions

    • Potential for repeated boosting without interference from vector immunity

    • Customization for specific host species

While live attenuated vaccines typically induce more robust and long-lasting immunity, carefully designed cdsA-based vaccines, particularly as part of a multi-component formulation, could overcome this limitation while providing significant practical and safety advantages that would make widespread vaccination programs more feasible, especially in endemic regions with limited veterinary infrastructure .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.