Recombinant Brucella abortus biovar 1 Probable ABC transporter permease protein BruAb2_0483 (BruAb2_0483)

Shipped with Ice Packs
In Stock

Description

Functional Role in Brucella Pathogenesis

ABC transporters like BruAb2_0483 are integral to bacterial survival and virulence. Key findings:

  • Ortholog Analysis: BruAb2_0483 shares homology with ABC transporters in Brucella melitensis and Brucella suis, suggesting conserved roles in nutrient uptake or toxin efflux .

  • Virulence Link: Mutants of ABC transporters in B. abortus (e.g., ExsA) exhibit reduced survival in host models, implicating BruAb2_0483 in intracellular persistence .

  • Mechanism: As a permease, BruAb2_0483 likely couples ATP hydrolysis to conformational changes, enabling substrate transport across membranes .

Research Applications

Recombinant BruAb2_0483 is widely used in:

Genetic and Genomic Context

The BruAb2_0483 gene resides on chromosome 2 of B. abortus 9-941, adjacent to genes encoding metabolic enzymes and regulatory proteins . Comparative genomics reveals:

Table 3: Genomic Comparison Across Brucella Species

SpeciesOrthologous GeneFunction
B. suis 1330BR0952Amino acid ABC transporter permease
B. melitensis 16MBMEII0834Glutamate-1-semialdehyde aminomutase

This synteny suggests evolutionary conservation of transporter-associated loci in Brucella .

Technical Considerations for Use

  • Solubility: May require refolding if expressed as inclusion bodies in E. coli .

  • Activity Assays: ATPase activity tests are recommended to validate functional integrity .

  • Storage: Lyophilized protein retains stability for >12 months at -80°C; avoid freeze-thaw cycles .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please specify them during order placement and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery times.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize development of the specified tag.
Synonyms
BruAb2_0483; Probable ABC transporter permease protein BruAb2_0483
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-289
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
BruAb2_0483
Target Protein Sequence
MQNRTLPYFLILPSLLLAAVVIFWPVVHLFEIATHDVNRFGQLREFNDGANFTALFATAE FMNALWRTAVWTVAVVGGALVLSIPVAIILNMDFYGRSVARVIIMLPWAVSLTMTAIFWR WALNGESGMLNSALHGLGLIDTNIQWLASAATAFPMQILVGILVTVPFTTTIFLGGLSSI PDDLYEASSLEGASLWQQFREITFPLLKPFVNIAIVLNTIYVFNSFPIIWVMTQGRPANS TDILVTHLYKLAFRLGKFGEASAVSLIMLAILLVFTVIYIRISTRSEQS
Uniprot No.

Target Background

Function
This protein is likely part of an ABC transporter complex. It is probably responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the predicted function of BruAb2_0483 based on comparison to other ABC transporters?

ABC transporters constitute one of the largest membrane protein families across most organisms, with diverse functions underpinning key physiological processes. Based on homology with other bacterial ABC transporters, BruAb2_0483 likely functions as a permease component of an ABC transport system, facilitating substrate translocation across the bacterial membrane .

Unlike some plant transporters like Arabidopsis ABCB14 that mediate malate uptake, bacterial ABC transporters often exhibit distinct substrate specificities that require experimental verification. Like other bacterial permeases, BruAb2_0483 likely forms a complex with nucleotide-binding proteins to create a functional transport system .

What expression systems are most suitable for producing recombinant BruAb2_0483?

For membrane proteins like BruAb2_0483, expression systems must be carefully selected to ensure proper folding and functionality. The pMAL expression system has been successfully used for other Brucella proteins, as demonstrated in the successful expression of B. abortus Ndk using PCR amplification into a pMAL expression system with subsequent purification .

A methodological approach would include:

  • PCR amplification of the BruAb2_0483 gene

  • Cloning into an appropriate expression vector (pMAL or similar)

  • Expression in a suitable host (typically E. coli)

  • Optimization of expression conditions (temperature, induction time)

  • Purification using affinity chromatography

For membrane proteins specifically, consider detergent screening to maintain protein stability and functionality throughout the purification process.

How can I verify the immunoreactivity of recombinant BruAb2_0483?

Testing immunoreactivity is crucial for validating recombinant protein production. Follow the approach used for other Brucella proteins where immunoreactivity testing showed specific reactions with Brucella-positive serum but not with Brucella-negative serum .

Methodological steps include:

  • Western blot analysis with Brucella-positive and Brucella-negative sera

  • ELISA assays to quantify binding affinity

  • Immunoprecipitation with specific antibodies

  • Cross-reactivity assessment with other Brucella proteins

This approach establishes whether your recombinant protein maintains native epitopes and can be recognized by the immune system, which is critical for functional studies .

What experimental strategies can determine substrate specificity of BruAb2_0483?

Determining substrate specificity for ABC transporters requires multiple complementary approaches. For BruAb2_0483, consider implementing the following methodological strategy:

  • Transport assays in reconstituted liposomes:

    • Incorporate purified BruAb2_0483 into liposomes

    • Test transport of radiolabeled or fluorescent substrates

    • Measure transport rates under varying conditions

  • Binding assays:

    • Determine substrate binding affinities using techniques like isothermal titration calorimetry

    • Assess competitive binding with potential substrates

  • Genetic approaches:

    • Generate knockout strains to assess phenotypic changes

    • Complement with wild-type or mutant versions of BruAb2_0483

  • Heterologous expression systems:

    • Express BruAb2_0483 in systems like E. coli or HeLa cells (similar to approaches used for Arabidopsis ABCB14)

    • Assess transport of candidate substrates

This multi-faceted approach mirrors successful strategies used to characterize other bacterial ABC transporters .

How can I design experiments to investigate BruAb2_0483's role in virulence?

To investigate BruAb2_0483's potential role in virulence, a systematic experimental approach incorporating both in vitro and in vivo models is recommended:

Experimental Design Table:

Experimental ApproachMethodologyOutput MeasurementsControls
Gene knockout studiesCRISPR-Cas9 or homologous recombination to generate ΔBruAb2_0483Growth rates, survival in stress conditionsWild-type, complemented strain
Infection assaysInfection of macrophage cell lines (e.g., RAW 264.7) with wild-type and mutant strainsInvasion efficiency, intracellular survival, cytokine productionHeat-killed bacteria
Animal modelsBALB/c mice challenge with wild-type and ΔBruAb2_0483 strainsBacterial burden in spleen, spleen proliferation, pathologyPBS injection, RB51 vaccine strain
Complementation studiesRe-introduction of BruAb2_0483 into knockout strainRestoration of virulence phenotypeEmpty vector control

This approach aligns with methods used to study other Brucella virulence factors, including assessment of bacterial burden in the spleen and spleen proliferation measurements following challenge with virulent strains .

What structural analysis techniques are most informative for ABC transporters like BruAb2_0483?

For structural analysis of ABC transporters like BruAb2_0483, several complementary techniques can provide insights into conformational dynamics and function:

  • EPR Spectroscopy with Site-Directed Spin Labeling:

    • Can measure distances and probe accessibility in ABC transporters

    • Has been successfully applied to P-glycoprotein and other ABC transporters

    • Allows analysis of conformational changes during the transport cycle

  • X-ray Crystallography:

    • Provides atomic-resolution structures in different conformational states

    • Requires optimization of crystallization conditions for membrane proteins

    • May require lipidic cubic phase techniques for membrane proteins

  • Molecular Dynamics (MD) Simulations:

    • Can model conformational dynamics based on available structural data

    • Useful for predicting drug binding sites and conformational changes

    • Complements experimental structural data from EPR or X-ray crystallography

  • X-ray Radiolytic Footprinting Combined with MS (XF-MS):

    • Promising technique for studying membrane protein dynamics

    • Permits identification of structural waters and conformational changes

    • Applicable to protein complexes, which is valuable for ABC transporters

These approaches have been successfully applied to ABC transporters like MsbA and P-gp to investigate conformational flexibility and compare dynamic data with mechanistic predictions from crystal structures .

How can I evaluate the potential of BruAb2_0483 as a subunit vaccine candidate?

Evaluating BruAb2_0483 as a subunit vaccine candidate requires a systematic assessment of immunogenicity and protective efficacy. Based on successful approaches with other Brucella proteins, the following methodology is recommended:

  • Immunization Protocol:

    • Immunize BALB/c mice subcutaneously with purified recombinant BruAb2_0483

    • Include appropriate controls (PBS, adjuvant only, commercial vaccine RB51)

    • Consider testing BruAb2_0483 both alone and in combination with other Brucella antigens

  • Immune Response Assessment:

    • Measure IgG antibody production, particularly IgG isotype distribution (IgG1 vs. IgG2a)

    • Analyze cytokine profiles (IFN-γ, IL-2, TNF, MCP1, IL-6, IL-10) to determine T-helper response bias

    • Assess cellular immunity through lymphocyte proliferation assays

  • Protection Studies:

    • Challenge immunized mice with virulent B. abortus

    • Measure bacterial burden in spleen and spleen proliferation

    • Compare protection levels with established vaccine strains like RB51

Previous studies with recombinant Brucella proteins have shown that effective candidates typically induce strong IgG2a responses (with titers >4.0) compared to IgG1, indicating a Th1-dominated immune response essential for protection against intracellular pathogens like Brucella .

What immunological parameters best predict protective efficacy of BruAb2_0483?

Based on studies with other Brucella antigens, certain immunological parameters strongly correlate with protective efficacy:

Predictive Immunological Parameters Table:

ParameterFavorable ProfileCorrelation with ProtectionMeasurement Method
IgG Isotype RatioIgG2a > IgG1High (indicates Th1 bias)ELISA (titers)
IFN-γ ProductionHigh levelsStrong positive correlationELISA, ELISpot, Flow cytometry
IL-10 ProductionLow levelsNegative correlationELISA
Proinflammatory CytokinesElevated TNF, MCP1, IL-6Positive correlationELISA, multiplex assays
T Cell ProliferationStrong antigen-specific responseModerate correlation[³H]-thymidine incorporation
Bacterial BurdenLow CFU counts in spleen post-challengeDirect measure of protectionViable bacteria count

For rNdk of B. abortus, IgG2a titers of 5.2 (compared to IgG1 titers of 4.8) were associated with protection, whereas in control mice (MBP-immunized), titers were only 2.4 for IgG2a and 2.6 for IgG1 . Similar patterns of IgG2a predominance were observed with combined subunit vaccines containing multiple Brucella proteins .

How should I design factorial experiments to analyze interactions between BruAb2_0483 and other factors?

Factorial designs are powerful for studying interactions between multiple factors affecting BruAb2_0483 function or expression. Follow these methodological guidelines:

  • Design Structure:

    • Identify primary factors (e.g., expression conditions, substrate presence, inhibitors)

    • Select appropriate levels for each factor (typically 2-3 levels)

    • Create a full factorial design to test all combinations

  • Model Formulation:

    • Use linear models appropriate for factorial designs

    • Include main effects and interaction terms

    • Consider transformations if necessary for normality

  • Analysis Approach:

    • Perform ANOVA to test main effects and interactions

    • Check specific comparisons with appropriate post-hoc tests

    • Interpret interactions carefully by examining simple effects

For analyzing BruAb2_0483, a typical 2×2 factorial design might examine the effects of temperature (low/high) and induction time (short/long) on protein expression yield, allowing detection of potential interaction effects where one factor's influence depends on the level of another factor .

What are best practices for analyzing data from BruAb2_0483 protection studies?

When analyzing protection studies involving BruAb2_0483, follow these methodological best practices derived from successful Brucella vaccine research:

  • Statistical Approaches:

    • Use appropriate statistical tests (ANOVA with post-hoc tests like Tukey's HSD)

    • Consider non-parametric alternatives when assumptions aren't met

    • Calculate sample sizes based on power analysis to detect meaningful differences

  • Data Transformation:

    • Log-transform CFU data to improve normality

    • Use appropriate transformations for other non-normal data

    • Check assumptions before and after transformation

  • Experimental Controls:

    • Include positive controls (established vaccines like RB51)

    • Include negative controls (PBS, adjuvant only)

    • Consider using single antigen controls when testing combinations

  • Correlation Analysis:

    • Examine correlations between immune parameters and protection

    • Use multiple regression to identify key predictive factors

    • Consider principal component analysis for complex datasets

Studies evaluating protection against B. abortus typically compare spleen bacterial burden and spleen proliferation between treatment groups, with statistical significance typically set at P < 0.01 or P < 0.05 .

What are common challenges in expressing membrane proteins like BruAb2_0483?

Membrane proteins like ABC transporters present specific challenges during recombinant expression. Address these with the following methodological approaches:

  • Protein Toxicity:

    • Use tightly regulated expression systems

    • Consider lower growth temperatures (16-25°C)

    • Use specialized host strains (C41, C43) designed for toxic proteins

  • Inclusion Body Formation:

    • Optimize induction conditions (IPTG concentration, temperature)

    • Consider fusion tags that enhance solubility (MBP, SUMO)

    • Experiment with different detergents for extraction and purification

  • Low Expression Yields:

    • Test multiple expression systems and host strains

    • Optimize codon usage for the host organism

    • Consider using specialized media formulations

  • Protein Misfolding:

    • Include chaperones or folding enhancers

    • Try expression in specialized compartments (periplasm)

    • Test expression in eukaryotic systems for complex proteins

These approaches have been successful for other membrane proteins and can be adapted for BruAb2_0483 expression .

How can I address non-specific binding issues in BruAb2_0483 immunological studies?

Non-specific binding can complicate immunological studies of BruAb2_0483. Implement these methodological solutions:

  • ELISA Optimization:

    • Include multiple blocking agents (BSA, milk proteins, serum)

    • Test different antibody dilutions and incubation conditions

    • Use highly purified protein preparations

    • Include irrelevant protein controls

  • Western Blot Improvements:

    • Increase stringency of washing steps

    • Optimize primary and secondary antibody concentrations

    • Include competition with excess unlabeled antibody

    • Pre-absorb sera with E. coli lysates if using E. coli-expressed proteins

  • Cross-Reactivity Assessment:

    • Test reactivity with Brucella-negative sera

    • Include closely related proteins as specificity controls

    • Use monoclonal antibodies when possible

Applying these approaches has been effective in ensuring specificity in immunoreactivity studies of other Brucella proteins, where recombinant proteins reacted specifically with Brucella-positive serum but not with Brucella-negative serum .

How might emerging technologies enhance our understanding of BruAb2_0483 function?

Several emerging technologies show promise for advancing research on ABC transporters like BruAb2_0483:

  • Cryo-Electron Microscopy:

    • Allows visualization of membrane proteins in native-like environments

    • Can capture different conformational states during transport cycle

    • Avoids crystallization challenges associated with membrane proteins

  • Advanced Mass Spectrometry Techniques:

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • Crosslinking mass spectrometry for interaction studies

    • Native mass spectrometry for intact complex analysis

  • Single-Molecule Techniques:

    • FRET studies to monitor conformational changes in real-time

    • Optical tweezers to study mechanical aspects of transport

    • Single-molecule tracking in live cells

  • Computational Approaches:

    • Long-timescale molecular dynamics simulations

    • Machine learning for predicting substrate specificity

    • Systems biology integration of transporter function

These technologies would complement existing approaches like EPR spectroscopy and X-ray crystallography to provide more comprehensive insights into the function of ABC transporters like BruAb2_0483 .

What is the potential of BruAb2_0483 in next-generation brucellosis vaccines?

The development of next-generation brucellosis vaccines could benefit from incorporating BruAb2_0483, particularly within multi-component subunit vaccine approaches:

  • Combined Subunit Vaccines:

    • Evaluate BruAb2_0483 in combination with established immunogens like ribosomal protein L7/L12, OMP22, OMP25, and OMP31

    • Test different combinations to identify synergistic effects

    • Assess protection levels compared to single subunit vaccines and traditional vaccines like RB51

  • Novel Delivery Systems:

    • Explore nanoparticle-based delivery of BruAb2_0483

    • Test liposomal formulations for enhanced immune responses

    • Evaluate DNA vaccine approaches encoding BruAb2_0483

  • Adjuvant Optimization:

    • Test various adjuvants to shape immune responses toward Th1

    • Evaluate cytokine adjuvants to enhance protective immunity

    • Consider mucosal adjuvants for alternative delivery routes

Research with other Brucella proteins has demonstrated that combined subunit vaccines (CSVs) can induce superior protective effects compared to single subunit vaccines, with protection levels comparable to established vaccines like RB51 . The potential for BruAb2_0483 to contribute to such multi-component approaches warrants thorough investigation, especially given the importance of inducing strong Th1-dominated immune responses for protection against brucellosis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.