Recombinant Brucella abortus biovar 1 Probable ABC transporter permease protein BruAb2_1124 (BruAb2_1124)

Shipped with Ice Packs
In Stock

Description

Functional Role in Brucella Biology

BruAb2_1124 is annotated as a probable ABC transporter permease, implicating it in nutrient uptake or efflux of metabolites critical for bacterial survival. Key functional insights include:

  • Mechanism: ABC transporters use ATP binding/hydrolysis to alternate between inward- and outward-facing conformations, enabling substrate translocation across membranes .

  • Pathogenicity Link: In Brucella, ABC transporters are hypothesized to import essential nutrients (e.g., vitamins, metals) during intracellular infection, facilitating host persistence .

  • Biochemical Role: BruAb2_1124 may partner with other subunits (e.g., solute-binding proteins) to form a functional transporter complex, though specific substrates remain unidentified .

Research Applications

This recombinant protein is critical for:

Vaccine Development

  • Serves as an antigen candidate for brucellosis vaccine research due to its surface-exposed epitopes in Brucella .

  • Used in immunogenicity studies to assess host antibody responses .

Mechanistic Studies

  • Facilitates structural and functional analyses of ABC transporter dynamics in Gram-negative bacteria .

  • Enables drug discovery efforts targeting bacterial nutrient uptake pathways .

Diagnostic Assays

  • Employed in ELISA-based detection systems (e.g., Cat# CSB-CF685026BWS) to identify Brucella-specific antibodies in clinical samples .

Key Research Findings and Gaps

  • Homology: BruAb2_1124 shares sequence similarity with ABC permeases in Salmonella and E. coli, suggesting conserved roles in stress adaptation .

  • Knowledge Gaps:

    • Substrate specificity and regulatory interactions are undefined .

    • In vivo validation of its role in Brucella virulence is lacking.

  • Therapeutic Potential: Targeting BruAb2_1124 could disrupt bacterial nutrient acquisition, but inhibitor design requires structural resolution .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary based on the purchasing method or location. Please contact your local distributor for specific delivery details.
Note: All protein shipments are standardly packaged with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is defined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
BruAb2_1124; Probable ABC transporter permease protein BruAb2_1124
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-250
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
BruAb2_1124
Target Protein Sequence
MNARLTGLGLNLLSFAVGIGGWYLLTATGAVVLPGPVDVLERAVTLLLNGQLVGDIFASL RRVLSGFVLGVALAIPVGFLMGWYRIARSLIEPWVQFFRMIPPLAVIPLAIVTLGIDESP KIFVIFLASFLSSVVATYQGVISVDRTLINAARVLGAKDATIFARVIVPASVPFILVGVR IGLGSAWATVVAAELIAAQSGLGYRMQQAQLYYDLPTIFVSLVTIGILGLFMDRLLQAAD RRLTQWQERA
Uniprot No.

Target Background

Function
This protein likely functions as part of an ABC transporter complex. It is likely responsible for the translocation of the substrate across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.