Recombinant Brucella abortus biovar 1 Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
htpX; BruAb1_1793; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-325
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
htpX
Target Protein Sequence
MNMTKTAMLIALMTVMFMSIGYLLGGGGGMMIALVIAVAMNLFGYWNSDKMVLRMYNAQE VDERSAPEYYRMVSGLAANAGLPMPKVYIIHEDQPNAFATGRNPENAAVAATTGLLNRLS PEEVAGVMAHELAHVQNRDTLTMTIVATLAGAISMLGNFAFFLGGNRENGNGVMGVVGTL LAMIVAPFGAMIVQMAVSRTREYAADKRGAEICGNPLWLSSALGRIARGAKVIPNEEAEH NPATAHMFIINPLSGRGADNLFSTHPDTDNRIAALEQMAAEMGIRSAAMTARAAAPSQNS GPWGQRSDNAGGNSNGGSRYRGPWS
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Brucella abortus Protease HtpX homolog?

The Protease HtpX homolog from Brucella abortus biovar 1 (strain 9-941) is a membrane-associated zinc metalloprotease (EC 3.4.24.-) with a full-length protein containing 325 amino acid residues . The protein's amino acid sequence begins with MNMTKTA and contains multiple hydrophobic regions that suggest transmembrane domains, which is consistent with its predicted membrane localization .

Functionally, the HtpX protease likely belongs to the family of proteases involved in protein quality control within the cell membrane, particularly in stress response. While the exact function in B. abortus has not been fully characterized, homologous proteases in other bacteria typically degrade misfolded or damaged membrane proteins, contributing to membrane protein homeostasis during stress conditions.

How does Brucella abortus HtpX compare to other bacterial proteases?

B. abortus encodes multiple proteases with different cellular functions. Unlike the well-studied rhomboid protease in B. abortus, which has been shown to cleave heterologous substrates like Drosophila melanogaster Gurken and Providencia stuartii TatA , the HtpX homolog has a different substrate specificity and cellular localization pattern.

B. abortus also expresses other proteases such as HtrA (a heat shock protein with protease activity), which has been investigated for its role in bacterial resistance to macrophage killing mechanisms . Unlike HtrA, which has been tested as a potential vaccine component, HtpX's immunogenic properties have not been extensively characterized. While HtrA did elicit immune responses in experimental models, it failed to confer protective immunity against B. abortus challenge .

What are the optimal storage conditions for recombinant HtpX protein preparations?

Recombinant HtpX protein should be stored in a Tris-based buffer containing 50% glycerol optimized for protein stability . For long-term storage, the protein should be kept at -20°C or -80°C, with the latter recommended for extended preservation periods . For working experiments, small aliquots should be prepared and stored at 4°C for up to one week to minimize protein degradation .

Repeated freezing and thawing cycles should be strictly avoided as they can lead to significant protein denaturation and loss of enzymatic activity . When designing experiments requiring multiple uses of the protein, researchers should prepare appropriately sized single-use aliquots to maintain protein integrity.

What expression systems are most effective for producing functional recombinant B. abortus HtpX protease?

Based on successful approaches with other B. abortus proteins, the most effective expression systems for membrane-associated proteases like HtpX include:

  • E. coli expression systems: The pETite N-His Kan vector system has been successfully used for expressing multiple B. abortus proteins . When expressing membrane proteins like HtpX, E. coli strains optimized for membrane protein expression, such as C41(DE3) or C43(DE3), may provide better yields.

  • Baculovirus expression systems: This approach has been successfully used for expressing other B. abortus proteins like GroEL, GroES, and HtrA . The advantage of this system is that it can provide proper protein folding and post-translational modifications.

For optimal expression of functional HtpX, consider the following methodological approach:

  • Clone the htpX gene into a vector containing an N-terminal His-tag for purification

  • Transform into an E. coli expression strain capable of handling membrane proteins

  • Induce protein expression at lower temperatures (16-20°C) to enhance proper folding

  • Use mild detergents during cell lysis and purification to maintain the native conformation

What purification strategies yield the highest purity and activity for recombinant HtpX?

A multi-step purification strategy is recommended for obtaining high-purity, active HtpX protease:

  • Immobilized Metal Affinity Chromatography (IMAC): Using the N-terminal His-tag, perform nickel or cobalt affinity purification with imidazole gradients. For membrane proteins like HtpX, adding appropriate detergents (such as n-dodecyl β-D-maltoside or CHAPS) to the buffers is critical.

  • Size Exclusion Chromatography (SEC): Further purify the IMAC-enriched protein to remove aggregates and contaminants.

  • Ion Exchange Chromatography: Optional additional step to remove remaining impurities based on charge differences.

To assess purity after each purification step, perform SDS-PAGE and Western blot analysis using anti-His antibodies or specific antibodies against HtpX. As demonstrated with other B. abortus proteins, yields between 0.029 and 0.260 mg/mL have been achieved using similar approaches .

How can researchers effectively assess the enzymatic activity of recombinant HtpX protease?

To characterize the enzymatic activity of recombinant HtpX protease, researchers should implement the following methodological approach:

  • Fluorogenic peptide substrates: Design peptide substrates containing a fluorophore and quencher separated by a sequence predicted to be cleaved by HtpX. Cleavage results in increased fluorescence that can be quantitatively measured.

  • Model substrate cleavage assays: Similar to the approach used with the B. abortus rhomboid protease, test HtpX against model substrates including heterologous proteins known to be cleaved by similar proteases .

  • Mass spectrometry-based approaches: Incubate HtpX with candidate substrates and analyze the reaction products using liquid chromatography-mass spectrometry (LC-MS) to identify cleavage sites.

  • In vitro membrane reconstitution: Since HtpX is a membrane protease, reconstitute the purified enzyme in liposomes or nanodiscs to create a native-like membrane environment for more physiologically relevant activity assays.

For all activity assays, include appropriate controls:

  • Heat-inactivated enzyme

  • Reactions with protease inhibitors (metalloprotease inhibitors like EDTA, 1,10-phenanthroline)

  • Catalytically inactive mutant (mutation in the active site)

What are the known or predicted substrates of B. abortus HtpX protease in its native environment?

While specific substrates of B. abortus HtpX have not been definitively characterized, potential substrates can be predicted based on proteomics studies and knowledge of homologous proteases:

  • Membrane proteins identified in differential proteomics: Shotgun proteomics approaches similar to those used in the B. abortus rhomboid protease study can identify potential HtpX substrates . Membrane-associated proteins that show altered abundance in HtpX knockout mutants are potential substrates.

  • Predicted substrates based on homology: In other bacteria, HtpX homologs typically target misfolded membrane proteins, particularly during stress conditions. Candidate substrates may include:

    • Damaged respiratory chain components

    • Misfolded membrane transporters

    • Stress-denatured membrane proteins

  • Protein quality control candidates: Proteins involved in B. abortus adaptation to intracellular environments, particularly those that become damaged during oxidative or pH stress within macrophages.

Analysis of the B. abortus proteome under various stress conditions in wild-type versus htpX deletion mutants would be required to definitively identify physiological substrates.

What is the role of HtpX in Brucella abortus virulence and survival within host cells?

The specific role of HtpX in B. abortus virulence has not been extensively characterized, but insights can be derived from understanding the pathogen's intracellular lifestyle and stress responses:

B. abortus is a facultative intracellular pathogen that must survive harsh conditions within host macrophages . As a membrane protease likely involved in protein quality control, HtpX may contribute to bacterial survival under stressful intracellular conditions by:

  • Maintaining membrane integrity: Degrading damaged membrane proteins to prevent accumulation of potentially toxic protein aggregates during intracellular stress.

  • Stress adaptation: Contributing to adaptation to acidic pH, oxidative stress, and nutrient limitation encountered within the macrophage.

  • Virulence factor regulation: Potentially processing virulence factors required for intracellular survival or trafficking.

Unlike the ExsA ABC transporter, which has been demonstrated to be critical for full virulence in mice models , or the rhomboid protease, which showed no obvious effect on virulence but affected growth under static conditions , the specific contribution of HtpX to virulence would need to be assessed through systematic deletion studies and infection models.

How does HtpX expression change during different stages of Brucella infection?

Experimental approach to characterize HtpX expression during infection:

  • Transcriptional analysis: Using qRT-PCR or RNA-seq to measure htpX gene expression at different stages of infection (early invasion, intracellular trafficking, replication within the endoplasmic reticulum, cell-to-cell spread).

  • Reporter strain construction: Creating a B. abortus strain with a fluorescent or luminescent reporter fused to the htpX promoter to track expression in real-time during infection.

  • Proteomics approach: Comparing protein abundance using quantitative proteomics at different infection timepoints, similar to the approach used in the rhomboid protease study .

Based on knowledge of related bacterial pathogens, HtpX expression may increase during stress conditions encountered within macrophages, particularly during phagosomal acidification and oxidative burst phases, when protein damage is most likely to occur. Changes in expression could be correlated with specific stages of the Brucella intracellular life cycle.

What are the best approaches for creating and validating htpX gene deletion mutants in Brucella abortus?

Creating a well-validated htpX deletion mutant requires a systematic approach:

  • Construction strategy:

    • Use homologous recombination with antibiotic resistance cassettes flanked by regions upstream and downstream of the htpX gene

    • Alternatively, employ CRISPR-Cas9 systems adapted for Brucella

    • For complementation studies, use plasmids containing the wild-type htpX gene under native or inducible promoters

  • Validation methods:

    • Southern blot analysis to confirm gene replacement, as successfully used for exsA mutant validation

    • PCR verification of deletion and integration sites

    • RT-PCR and Western blot to confirm absence of htpX transcription and translation

    • Whole genome sequencing to rule out additional mutations

  • Complementation controls:

    • Restore the wild-type phenotype by introducing the htpX gene in trans

    • Include both native promoter and inducible promoter constructs

    • Validate expression levels of the complemented gene

  • Phenotypic characterization:

    • Compare growth curves under standard and stress conditions

    • Assess intracellular survival in macrophage infection models

    • Evaluate virulence in mouse models similar to approaches used for exsA mutant analysis

What techniques can be used to identify protein interactions with HtpX in Brucella?

Multiple complementary approaches can be used to identify HtpX protein interactions:

  • Co-immunoprecipitation (Co-IP):

    • Express epitope-tagged HtpX in B. abortus

    • Perform crosslinking prior to cell lysis to capture transient interactions

    • Immunoprecipitate using anti-tag antibodies

    • Identify interacting partners by mass spectrometry

  • Bacterial two-hybrid system:

    • Adapt bacterial two-hybrid systems for membrane proteins

    • Screen for interactors from a B. abortus genomic library

  • Proximity-dependent biotin identification (BioID):

    • Fuse HtpX to a promiscuous biotin ligase

    • Express in B. abortus and allow in vivo biotinylation of proximal proteins

    • Purify biotinylated proteins and identify by mass spectrometry

  • Quantitative proteomics:

    • Compare membrane proteomes of wild-type and ΔhtpX strains under various conditions

    • Identify proteins with altered abundance or post-translational modifications

    • Similar to the approach used for rhomboid protease characterization which identified 108 differentially represented proteins

  • Crosslinking mass spectrometry:

    • Use chemical crosslinkers that specifically target amino acid residues in close proximity

    • Digest crosslinked protein complexes and identify by specialized mass spectrometry approaches

What methods are most effective for raising antibodies against B. abortus HtpX for research applications?

Based on successful approaches with other B. abortus proteins, effective antibody production against HtpX should consider:

  • Antigen preparation:

    • For membrane proteins like HtpX, use recombinant soluble domains or synthetic peptides from predicted extracellular/periplasmic regions

    • Alternatively, use detergent-solubilized full-length protein purified under non-denaturing conditions

    • Ensure high purity (>95%) of the antigen preparation

  • Immunization protocol:

    • For polyclonal antibodies: Immunize rabbits with 250-500 μg protein in combination with Freund's or Ribi adjuvant, similar to protocols used for other B. abortus proteins

    • For monoclonal antibodies: Immunize mice, perform fusion, and screen hybridomas for specific antibody production

    • Use multiple booster immunizations at 2-3 week intervals

  • Antibody validation methods:

    • Western blot against recombinant protein and B. abortus lysates

    • Immunoprecipitation efficiency testing

    • Immunofluorescence microscopy to confirm specific localization

    • Testing against ΔhtpX mutant strains as negative controls

  • Purification strategies:

    • Affinity purification using immobilized recombinant HtpX

    • Cross-adsorption against E. coli lysates to remove non-specific antibodies

Can HtpX be used as a diagnostic marker or vaccine candidate for brucellosis?

The potential of HtpX as a diagnostic marker or vaccine candidate must be evaluated systematically:

  • Diagnostic potential:

    • Evaluate serum antibody responses to HtpX in infected versus non-infected animals using ELISA

    • Compare sensitivity and specificity with established antigens like BP26, which showed 90.27% diagnostic sensitivity and 95.58% specificity

    • Determine if HtpX avoids cross-reactivity issues with Y. enterocolitica O:9 antibodies (a significant advantage noted for several B. abortus proteins)

  • Vaccine candidate assessment:

    • Evaluate immunogenicity similar to studies on HSPs (GroEL, GroES, HtrA)

    • Test for both humoral (antibody) and cellular (T-cell) responses

    • Assess protective immunity in mouse models following immunization

  • Comparative evaluation with other antigens:

    • Previous studies with B. abortus heat shock proteins showed they induced immune responses but failed to confer protective immunity

    • Compare HtpX performance with successful candidates like BP26, BLS, and SodC which showed better diagnostic potential

Protein AntigenDiagnostic SensitivityDiagnostic SpecificityYouden's IndexArea Under Curve
BP2690.27%95.58%0.85840.953
BLSNot specifiedNot specifiedNot specifiedNot specified
SodCNot specifiedNot specifiedNot specifiedNot specified
HtpXTo be determinedTo be determinedTo be determinedTo be determined

Note: This table shows the diagnostic performance of BP26 compared to other B. abortus protein antigens, with HtpX values to be determined through research.

How can structural biology approaches be used to characterize HtpX and design inhibitors?

Advanced structural characterization of HtpX can provide insights into its function and facilitate inhibitor design:

  • Structural determination approaches:

    • X-ray crystallography: Challenging for membrane proteins like HtpX, but possible with crystallization in lipidic cubic phases or detergent micelles

    • Cryo-electron microscopy: Increasingly valuable for membrane protein structure determination

    • NMR spectroscopy: Particularly useful for dynamic regions and substrate binding studies

  • Homology modeling:

    • Generate structural models based on homologous proteases with known structures

    • Validate models through site-directed mutagenesis of predicted catalytic residues

    • Refine models using molecular dynamics simulations in a membrane environment

  • Structure-based inhibitor design:

    • Identify the catalytic site based on structural data or homology

    • Perform virtual screening of compound libraries against the active site

    • Design transition-state analogs that mimic the proteolytic reaction intermediate

    • Develop peptidomimetic inhibitors based on substrate specificity profiling

  • Methodological considerations:

    • Expression and purification must be optimized for structural studies

    • Detergent selection is critical for maintaining native conformation

    • Consider using nanodiscs or amphipols for more native-like membrane environments

What computational approaches can predict HtpX substrates and cleavage sites?

Computational prediction of HtpX substrates and cleavage sites can accelerate experimental characterization:

  • Machine learning approaches:

    • Train models on known substrates of homologous proteases

    • Use features such as amino acid composition, secondary structure, and surface accessibility

    • Implement deep learning approaches for prediction without predefined features

  • Molecular docking and dynamics:

    • Perform docking simulations between HtpX model and potential substrates

    • Use molecular dynamics to simulate the interaction and estimate binding energy

    • Evaluate the positioning of potential cleavage sites relative to the catalytic residues

  • Sequence motif analysis:

    • Identify conserved sequence motifs around cleavage sites of homologous proteases

    • Search for these motifs in the B. abortus proteome

    • Prioritize membrane proteins with predicted transmembrane domains

  • Network analysis:

    • Integrate protein-protein interaction data, co-expression networks, and functional associations

    • Identify proteins that cluster with known substrates of homologous proteases

    • Predict functional relationships that suggest potential HtpX substrates

  • Validation of computational predictions:

    • Design synthetic peptides spanning predicted cleavage sites

    • Test cleavage in vitro using purified HtpX

    • Perform targeted proteomics to verify predicted cleavage in vivo

How does HtpX function integrate with other stress response systems in B. abortus?

Understanding how HtpX functions within the broader stress response network requires a systems biology approach:

  • Transcriptomic integration:

    • Perform RNA-seq comparing wild-type and ΔhtpX strains under various stress conditions

    • Identify genes with altered expression patterns

    • Map changes to known stress response pathways

  • Regulon analysis:

    • Identify potential transcription factors regulating htpX expression

    • Compare with regulons of other stress response genes

    • Perform ChIP-seq to identify direct regulators

  • Protein interaction network:

    • Map interactions between HtpX and other stress response proteins

    • Similar to studies of the rhomboid protease that identified connections to denitrification enzymes and cytochrome c oxidase

  • Phenotypic integration:

    • Compare phenotypes of ΔhtpX with mutants in other stress response systems

    • Test for synthetic phenotypes in double mutants

    • Assess adaptation to various stressors (oxidative, pH, temperature)

Based on evidence from the rhomboid protease study, HtpX may integrate with systems involved in growth under low oxygen conditions, potentially interacting with denitrification pathways or high oxygen affinity cytochrome c oxidase .

What methodologies are best for investigating HtpX contribution to B. abortus membrane protein homeostasis?

To investigate HtpX's role in membrane protein homeostasis, researchers should employ:

  • Membrane proteome analysis:

    • Compare membrane proteomes of wild-type and ΔhtpX strains using quantitative proteomics

    • Analyze changes in abundance, post-translational modifications, and turnover rates

    • Employ stable isotope labeling to measure protein synthesis and degradation rates

  • Stress response profiling:

    • Challenge bacteria with stressors that typically damage membrane proteins (heat shock, oxidative stress)

    • Measure accumulation of protein aggregates in wild-type versus ΔhtpX strains

    • Assess membrane integrity under stress conditions

  • Protein misfolding sensors:

    • Introduce reporter proteins prone to misfolding into wild-type and ΔhtpX strains

    • Monitor their degradation rates and aggregation tendencies

    • Use fluorescent protein fusions to track localization and aggregation in vivo

  • Integration with other quality control systems:

    • Investigate genetic interactions with other proteases (HtrA, FtsH)

    • Create and characterize double mutants

    • Assess the relative contribution of each system to membrane protein quality control

  • In vivo substrate trapping:

    • Generate catalytically inactive HtpX variants that bind but don't cleave substrates

    • Express these "substrate traps" in B. abortus

    • Identify trapped substrates by co-immunoprecipitation and mass spectrometry

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.