Recombinant Brucella abortus biovar 1 Protein CrcB Homolog 1 (crcB1) is a fluoride ion transporter homolog expressed in Escherichia coli for research applications. Derived from the pathogenic bacterium Brucella abortus, this protein is associated with ion transport and stress response mechanisms in bacterial cells . Its recombinant form enables biochemical and immunological studies without handling live Brucella, which is a biosafety hazard .
| Parameter | Specification |
|---|---|
| Protein Length | Full-length (1–270 amino acids) |
| Molecular Weight | ~30 kDa (predicted) |
| Purity | >90% (SDS-PAGE) |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Storage Conditions | -20°C/-80°C (lyophilized powder) |
| Reconstitution | Deionized sterile water (0.1–1.0 mg/mL) |
Fluoride Transport: CrcB1 is implicated in fluoride ion efflux, a mechanism critical for bacterial survival under stress .
Stress Adaptation: Homologs like BrnT/BrnA in Brucella form toxin-antitoxin systems that regulate persistence during host infection .
While crcB1 itself is not directly linked to vaccine development, recombinant Brucella proteins (e.g., L7/L12, Omp16/19/28) are known to induce Th1 immune responses, suggesting potential for crcB1 in similar applications .
Protein-Protein Interaction Studies: Utilized in assays to identify binding partners in Brucella membrane complexes .
Antibody Production: Immunogen for generating anti-Brucella antibodies due to high purity and specificity .
Stress Response Modeling: Used to investigate fluoride resistance mechanisms in gram-negative bacteria .
Reconstitution: Centrifuge vial before reconstitution; add glycerol (5–50%) for long-term storage .
Stability: Avoid repeated freeze-thaw cycles; working aliquots stable at 4°C for ≤1 week .
Knowledge Gaps: Direct evidence linking crcB1 to Brucella virulence or host interaction remains limited.
Therapeutic Potential: Exploration in multi-antigen subunit vaccines (e.g., combined with L7/L12 or Omp proteins) could enhance protective efficacy .
KEGG: bmb:BruAb1_1366
Brucella abortus CrcB1 (UniProt ID: Q57CD7) functions as a putative fluoride ion transporter. The protein consists of 270 amino acids and is classified among the membrane transport proteins in Brucella species . As a transmembrane protein, CrcB1 likely plays a role in ion homeostasis within the bacterial cell, potentially contributing to pathogen survival mechanisms in hostile environments. The protein's structure includes multiple transmembrane domains that facilitate its function in ion transport across the bacterial membrane.
CrcB1 differs significantly from better-characterized Brucella membrane proteins such as the outer membrane proteins (Omps) used in serodiagnostic applications . While Omps are predominantly located in the outer membrane and often serve as antigenic determinants, CrcB1 is a transmembrane protein with a specific ion transport function. The amino acid sequence of full-length CrcB1 (1-270 aa) contains hydrophobic regions consistent with its membrane-spanning function . Unlike some Brucella proteins that have been extensively studied for vaccine development, such as Adk and SecB, CrcB1's role in pathogenesis and its immunogenic properties remain less characterized .
For laboratory-scale production of recombinant CrcB1, Escherichia coli-based expression systems have proven effective. The commercially available recombinant CrcB1 is produced using E. coli with an N-terminal His tag for purification purposes . For membrane proteins like CrcB1, E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) may improve yield and proper folding.
The methodology for expression typically includes:
Cloning the crcB1 gene into an appropriate expression vector (such as pET systems)
Transformation into a suitable E. coli strain
Induction of protein expression under optimized conditions (temperature, IPTG concentration)
Cell harvesting and lysis
Protein purification via affinity chromatography utilizing the His tag
Similar methodologies have been successfully employed for other Brucella proteins, as demonstrated in studies with Adk and SecB recombinant proteins that were expressed in E. coli DH5α using the pcold-TF expression system .
Purification of membrane proteins like CrcB1 presents specific challenges compared to soluble proteins. The critical considerations include:
The published protocols for CrcB1 purification recommend reconstitution in deionized sterile water to a concentration of 0.1-1.0 mg/mL, with the addition of 5-50% glycerol (final concentration) for long-term storage at -20°C/-80°C . This method has been shown to maintain protein integrity and functional properties.
Based on studies with other Brucella proteins, CrcB1 could be evaluated as a potential vaccine candidate. Research on recombinant Adk and SecB proteins has demonstrated their ability to induce both humoral and cell-mediated immune responses in mice . These proteins elicited production of proinflammatory cytokines (TNF and IL-6), enhanced IFN-γ production, and decreased IL-10 production, indicating activation of both innate and adaptive immunity .
A methodological approach to evaluating CrcB1 as a vaccine candidate would include:
Immunization studies in appropriate animal models (e.g., BALB/c mice)
Assessment of cytokine profiles post-immunization
Measurement of specific antibody responses (IgG1, IgG2a)
Evaluation of T-cell responses (CD4+ population analysis)
Challenge studies to determine protective efficacy
Bacterial burden assessment in target organs (spleen)
The goal would be to determine if CrcB1, either alone or in combination with other antigens, could confer significant protection against Brucella abortus infection, similar to the protection observed with Adk and SecB in mouse models .
This question requires advanced experimental approaches, as the specific expression pattern of CrcB1 during infection has not been extensively characterized in the provided literature. By comparison, we can look at regulatory mechanisms of other Brucella genes like ccrM, which is essential for viability and regulated by the CtrA response regulator .
To investigate CrcB1 expression patterns, researchers could employ:
qRT-PCR analysis of crcB1 transcript levels during different infection phases
Reporter gene constructs (e.g., crcB1 promoter-GFP fusions) to monitor expression in real-time
Proteomics approaches to quantify CrcB1 protein levels in various infection stages
Chromatin immunoprecipitation (ChIP) to identify potential transcriptional regulators
RNA-seq analysis comparing intracellular versus extracellular bacterial populations
Understanding the expression dynamics of CrcB1 could provide insights into its potential role in Brucella pathogenesis and adaptation to the intracellular environment.
Determining the structure-function relationship of CrcB1 would enhance our understanding of its role in fluoride ion transport and potential contributions to bacterial survival. Recommended methodological approaches include:
Site-directed mutagenesis of conserved residues in the CrcB1 sequence to identify critical functional domains
Fluoride ion transport assays using reconstituted proteoliposomes containing purified CrcB1
Crystallography or cryo-electron microscopy for structural determination
Molecular dynamics simulations to model ion transport mechanisms
Electrophysiological techniques to measure ion transport activity
The amino acid sequence of CrcB1 (MLDIIILVVIGGAFGAMTREFIMLMVPPLTDGFPLDILVANVVACFLLGTVTALYARKIHSRDVHTIIGTGMMGGVSTFSSFAYGSVVLASASMSAFLIAAAYVTVSVVAGYVAVLAGMKFGEKSADILHRYPPMASIIDSGLVTVESRHSVAETIERVAAKAKSMGMNVFTRVDHGAGAKEAGLGLPPTELIIFGNPQNGTVLMQDKRTIGLDLPIRALAWEDGSGKVWLTVNDPAWLAQRHSLGLSSDVAIKAMVTGTGTVTKYAAGD) can serve as the starting point for these analyses, with particular attention to regions that share homology with other known ion transporters.
An integrative approach to Brucella research should consider how CrcB1 functions alongside other essential proteins like CcrM DNA methyltransferase. CcrM has been shown to be essential for Brucella abortus viability, with disruption of the gene being lethal . Similarly, investigating whether CrcB1 is essential for bacterial survival would provide valuable insights.
Research integration strategies could include:
Comparative genomics to identify conserved CrcB1 homologs across Brucella species and biovars
Conditional knockdown systems to assess essentiality under various environmental conditions
Protein-protein interaction studies to identify functional partners of CrcB1
Metabolomic analyses to determine the impact of CrcB1 dysfunction on bacterial physiology
Transcriptional network analyses to position CrcB1 within regulatory pathways
The goal would be to develop a systems biology perspective on how CrcB1 contributes to Brucella physiology and pathogenesis, potentially identifying multiple targets for intervention strategies.
Determining the contribution of CrcB1 to virulence requires robust animal model systems. Based on methodologies used with other Brucella proteins, researchers could:
Generate conditional CrcB1 mutants if the gene proves essential (similar to approaches used with ccrM)
Create strains with varying CrcB1 expression levels
Evaluate bacterial survival in murine macrophages (as performed with CcrM variants)
Assess bacterial burden in spleens of infected mice at various time points
Measure inflammatory responses in infected tissues
Compare virulence with wild-type strains in various infection routes
Previous research has demonstrated that altered expression of essential genes like ccrM affects Brucella morphology, DNA replication, and growth in murine macrophages . Similar investigations with CrcB1 would clarify its potential role in virulence and host adaptation.