Recombinant Brucella abortus biovar 1 Protein CrcB homolog 2 (crcB2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a particular tag type, please specify this in your order, and we will prioritize its use.
Synonyms
crcB2; BruAb1_1367; Putative fluoride ion transporter CrcB 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
crcB2
Target Protein Sequence
MTPLDVMWVCLGGGVGSLGRWWIGRIVGEYHHGAFPLGTFLINISGAFVIGYLSVLFGVD WHDRYGTMLNAGVLTGILGGYTTFSSMQLDAVKLSHKGQGGLAVFYLVASVLSGLFAAWL GAMLAHLQG
Uniprot No.

Target Background

Function

Important for reducing intracellular fluoride concentration, thereby mitigating its toxicity.

Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of the crcB2 gene in Brucella abortus biovar 1?

The crcB2 gene (BruAb1_1367) is located within the Brucella abortus biovar 1 (strain 9-941) genome, which consists of two circular chromosomes of 2,124,242 bp (Chr I) and 1,162,780 bp (Chr II). The complete genome contains 3,296 open reading frames (ORFs), with 2,158 on Chr I and 1,138 on Chr II. The G+C content of both chromosomes is approximately 57.2-57.3% . Within this genomic landscape, the crcB2 gene represents one of multiple homologs potentially involved in ion channel regulation, specifically fluoride resistance mechanisms that are conserved across bacterial species.

How can the crcB2 gene be cloned and expressed in a bacterial system?

For efficient cloning and expression of recombinant CrcB homolog 2 protein, researchers should follow a methodology similar to that used for other Brucella proteins:

  • PCR amplification of the crcB2 gene (BruAb1_1367) from B. abortus biovar 1 (strain 9-941) genomic DNA using specific primers that incorporate appropriate restriction enzyme sites.

  • Cloning the amplified gene into a suitable expression vector (such as pET series vectors) that provides a fusion tag (His-tag is commonly used) to facilitate purification.

  • Transform the recombinant plasmid into an E. coli expression host (BL21(DE3) or similar strains).

  • Culture the transformed bacteria in LB medium containing appropriate antibiotics until the OD600 reaches approximately 0.6-0.8.

  • Induce protein expression with IPTG (typically 0.5-1.0 mM) for 4-6 hours at 25-37°C, with temperature optimization required as membrane proteins often express better at lower temperatures.

  • Harvest cells by centrifugation and lyse using sonication or other mechanical methods in a buffer containing detergents suitable for membrane protein solubilization.

  • Purify the recombinant protein using affinity chromatography (Ni-NTA for His-tagged proteins), followed by size exclusion chromatography for higher purity .

What storage conditions are optimal for maintaining the stability of purified recombinant CrcB2 protein?

Recombinant CrcB2 protein stability can be maintained by storing in Tris-based buffer with 50% glycerol. For short-term storage, maintain working aliquots at 4°C for up to one week. For extended storage, keep at -20°C or -80°C, avoiding repeated freeze-thaw cycles as this can compromise protein integrity . If working with the membrane-associated form of the protein, the presence of appropriate detergents in the storage buffer is essential to prevent protein aggregation.

How can researchers effectively analyze the function of CrcB homolog 2 in fluoride resistance in Brucella abortus?

To comprehensively analyze CrcB2's role in fluoride resistance:

  • Generate knockout mutants of the crcB2 gene in B. abortus using CRISPR-Cas9 or homologous recombination techniques.

  • Create complementation strains by reintroducing the wild-type or mutated crcB2 gene.

  • Perform fluoride sensitivity assays by exposing wild-type, knockout, and complemented strains to varying concentrations of NaF (typically 1-100 mM) in different growth media and measuring growth inhibition.

  • Conduct electrophysiological studies using techniques such as patch-clamp on membrane preparations or reconstituted proteoliposomes containing purified CrcB2 to directly measure fluoride ion transport.

  • Implement fluoride-specific reporter systems using fluorescent probes that respond to intracellular fluoride concentrations.

  • Use site-directed mutagenesis to identify critical residues involved in ion selectivity and channel function.

  • Correlate findings with bacterial survival and virulence in cellular infection models using macrophage cell lines such as J774A.1, which have been successfully used in Brucella research .

What are the potential interactions between CrcB homolog 2 and other proteins in the Brucella abortus proteome?

To investigate protein-protein interactions involving CrcB2:

  • Implement pull-down assays using recombinant His-tagged CrcB2 as bait to capture potential interaction partners from B. abortus cell lysates.

  • Perform bacterial two-hybrid screening to identify direct protein interactions in vivo.

  • Utilize co-immunoprecipitation with anti-CrcB2 antibodies followed by mass spectrometry to identify protein complexes.

  • Analyze genomic context of crcB2 to identify functionally related genes that might be co-expressed or co-regulated.

  • Conduct transcriptomic analysis under fluoride stress conditions to identify genes with expression patterns correlated with crcB2.

  • Employ crosslinking mass spectrometry (XL-MS) to capture transient interactions within the membrane environment.

  • Investigate interaction with immunity-related proteins given that ion channels can potentially influence bacterial survival within host immune cells, similar to how other Brucella proteins modulate the immune response .

How does CrcB homolog 2 contribute to Brucella abortus virulence and intracellular survival?

To investigate the role of CrcB2 in virulence:

  • Compare intracellular survival rates of wild-type and crcB2 knockout strains in professional phagocytes like RAW264.7 cells or primary macrophages at various time points post-infection.

  • Measure bacterial loads in organs of BALB/c mice (a common model for Brucella studies) infected with wild-type versus crcB2 mutant strains.

  • Analyze the effect of crcB2 deletion on cytokine production (particularly IL-12, IFN-γ, and IL-10) in infected macrophages and animal models, as these have been shown to be important in controlling Brucella infections .

  • Determine whether crcB2 expression affects bacterial survival under various stress conditions encountered within macrophage phagosomes (oxidative stress, acidic pH, nutrient limitation).

  • Investigate potential synergistic effects when crcB2 is modified alongside other virulence-associated genes, such as those involved in Type IV secretion systems that are critical for Brucella pathogenesis.

  • Evaluate whether crcB2 expression levels change during different phases of cellular infection, from invasion to intracellular replication.

What methodological approaches can be used to investigate the structure-function relationship of CrcB homolog 2?

To elucidate structure-function relationships:

  • Perform site-directed mutagenesis of conserved residues identified through sequence alignment with other bacterial CrcB proteins, particularly targeting the transmembrane domains and potential ion coordination sites.

  • Generate a series of truncated variants to identify minimal functional domains.

  • Use structural biology techniques such as X-ray crystallography or cryo-electron microscopy, although these may be challenging for membrane proteins and might require:

    • Expression with fusion partners that enhance solubility and crystallization

    • Use of lipidic cubic phase crystallization methods

    • Incorporation into nanodiscs for cryo-EM studies

  • Implement computational molecular dynamics simulations to model ion permeation and selectivity mechanisms.

  • Utilize hydrogen-deuterium exchange mass spectrometry (HDX-MS) to identify conformational changes upon fluoride binding.

  • Apply fluorescence resonance energy transfer (FRET) approaches to monitor conformational changes during channel gating.

How can CrcB homolog 2 be incorporated into novel vaccine development strategies against Brucellosis?

Building upon established Brucella vaccine research:

  • Design recombinant RB51 vaccine strains that overexpress CrcB2 protein to determine if this enhances antigen presentation or immune response. This approach would be similar to studies that have enhanced the RB51 strain with other proteins like listeriolysin O (LLO) .

  • Create fusion constructs combining CrcB2 with known immunodominant Brucella antigens or immune-stimulating proteins like BAX and SMAC, which have shown promise in enhancing Th1 immune responses .

  • Evaluate whether CrcB2-based vaccines induce protective cell-mediated immunity by measuring:

    • IFN-γ production by splenocytes from vaccinated animals

    • CD4+ and CD8+ T cell proliferation in response to stimulation

    • Protection levels against challenge with virulent B. abortus

  • Compare immune responses between different administration routes (intraperitoneal, subcutaneous, mucosal) to optimize delivery.

  • Analyze cross-protection against other Brucella species given the high sequence similarity between B. abortus, B. melitensis, and B. suis proteins (typically >99% amino acid identity) .

How does CrcB homolog 2 sequence compare across different Brucella species and what are the implications for functional conservation?

The high sequence conservation observed among Brucella species (>99% amino acid identity for most proteins) suggests that CrcB homolog 2 likely maintains similar functions across the genus. To investigate this:

  • Perform comprehensive phylogenetic analysis of crcB2 sequences from all available Brucella genomes, including:

    • B. abortus biovar 1 (strain 9-941)

    • B. melitensis 16M

    • B. suis 1330

    • Other Brucella species and biovars

  • Identify any species-specific sequence variations that might correlate with host preference or virulence differences.

  • Compare selection pressure across different regions of the protein by calculating dN/dS ratios to identify functionally critical domains under purifying selection.

  • Analyze the genomic context of crcB2 across Brucella species to determine if gene synteny is maintained or if there are species-specific differences in gene neighborhoods.

  • Examine whether the number and arrangement of crcB homologs vary across Brucella species, as gene duplication and divergence might indicate functional specialization.

What methodological approaches are recommended for resolving contradictory experimental data regarding CrcB homolog 2 function?

When faced with contradictory results in CrcB2 research:

  • Systematically evaluate experimental conditions that might influence outcomes:

    • Growth media composition (particularly fluoride concentrations)

    • Bacterial growth phase

    • Host cell types in infection models

    • Protein expression levels and tags used

  • Implement multiple complementary techniques to address the same question, such as combining genetic approaches (gene knockout) with biochemical methods (ion transport assays) and structural studies.

  • Use quantitative rather than qualitative measurements wherever possible, with appropriate statistical analysis.

  • Conduct dose-response experiments rather than single-dose studies to identify potential threshold effects.

  • Consider strain-specific differences by testing multiple isolates of B. abortus.

  • Validate key findings through independent laboratories using standardized protocols.

  • Incorporate controls that can distinguish between direct effects of CrcB2 and indirect consequences of fluoride toxicity or membrane perturbation.

What novel applications might emerge from further characterization of CrcB homolog 2?

Further research into CrcB2 could lead to several innovative applications:

  • Development of new antimicrobial strategies targeting bacterial fluoride channels, potentially circumventing existing resistance mechanisms.

  • Design of biosensors for environmental fluoride detection using engineered CrcB2 variants coupled with reporter systems.

  • Creation of attenuated bacterial strains with modified fluoride sensitivity for vaccine development.

  • Engineering bacterial strains with enhanced fluoride resistance for biotechnology applications in fluoride-contaminated environments.

  • Using CrcB2 as a model system for understanding ion channel evolution and adaptation in intracellular pathogens.

  • Developing CrcB2-based drug delivery systems that could specifically target Brucella-infected cells.

What are the critical controls needed when studying recombinant CrcB homolog 2 in cellular infection models?

When designing experiments to study CrcB2 in infection models:

  • Include appropriate strain controls:

    • Wild-type B. abortus 9-941

    • crcB2 deletion mutant

    • Complemented strain (mutant with restored wild-type crcB2)

    • Strain expressing a non-functional CrcB2 variant with point mutations

  • Monitor bacterial viability before infection to ensure comparable initial inocula.

  • Validate protein expression and localization using techniques such as:

    • Western blotting with anti-CrcB2 antibodies

    • Immunofluorescence microscopy to confirm membrane localization

    • Flow cytometry to quantify expression in bacterial populations

  • Include controls for host cell responses:

    • Uninfected cells

    • Cells treated with heat-killed bacteria

    • Cells infected with non-pathogenic control bacteria

  • Measure multiple parameters of infection:

    • Bacterial invasion (CFU at 1-2 hours post-infection)

    • Intracellular survival (CFU at 24, 48, 72 hours)

    • Host cell viability and cytokine production

    • Phagosome-lysosome fusion using appropriate markers

  • Implement appropriate statistical analysis with sufficient biological and technical replicates (minimum n=3 for each condition).

This comprehensive FAQ collection provides researchers with both fundamental information and advanced methodological approaches for investigating Recombinant Brucella abortus biovar 1 Protein CrcB homolog 2, supporting rigorous scientific inquiry into this potentially significant bacterial protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.