Recombinant Brucella abortus biovar 1 Protein CrcB homolog 3 (crcB3)

Shipped with Ice Packs
In Stock

Description

Biological Context of CrcB3

CrcB homologs are implicated in bacterial stress responses. In Brucella abortus, small proteins under transcriptional regulator VtlR control localize to bacterial membranes and respond to oxidative stress, acidic conditions, and stationary-phase growth . While the studied VtlR-regulated proteins (BAB1_0914, BAB2_0512, BAB2_0574) are distinct from CrcB3, their membrane association suggests a potential role for CrcB3 in similar stress adaptation mechanisms .

Potential Functional Roles

CrcB family proteins are broadly associated with:

  • Chloride Ion Transport: Structural homology suggests involvement in chloride channel activity .

  • Stress Adaptation: Membrane localization may facilitate responses to environmental stressors like pH changes or oxidative damage .

Research Applications

This recombinant protein is primarily utilized for:

  1. Antigen Characterization: Detecting Brucella-specific immune responses via ELISA .

  2. Structural Studies: Investigating membrane protein interactions using His-tag affinity purification .

  3. Vaccine Development: As part of multi-antigen subunit vaccines, though current candidates focus on other proteins (e.g., OMP22, L7/L12) .

Comparative Insights from Related Studies

  • Phylogenetic Distribution: B. abortus strains show clade-specific diversity, with African lineages (clades A/B) exhibiting greater genetic variation than globally dominant clade D .

  • Membrane Protein Immunogenicity: Surface-exposed loops in Brucella membrane proteins (e.g., CypA/CypB) often contain immunodominant epitopes, suggesting CrcB3 could be explored for antibody generation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
crcB3; BruAb2_0414; Putative fluoride ion transporter CrcB 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-137
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
crcB3
Target Protein Sequence
MRNWRQAENIRLYIAVGCGAAIGALLRFLSGWVIVAILGANPLWGTSFVNIVGSFIIMFF ATLTGPEGRWLVSPAWRQFVMGGLCGGLTTFSSMSLDTFLLVLHGNAAFALAYLCGLVFL SLSAAMLGLIAAQRINR
Uniprot No.

Target Background

Function
Crucial for reducing intracellular fluoride concentration and its associated toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the predicted functional role of crcB3 in Brucella abortus?

Based on annotation data, crcB3 is believed to function as a fluoride ion transporter. This classification is supported by its similarity to other CrcB family proteins that typically mediate fluoride efflux, which is critical for bacterial survival in environments containing fluoride ions. The protein's transmembrane topology suggests it forms channels across the bacterial membrane to facilitate ion movement .

While direct experimental validation of crcB3's ion transport function in B. abortus is still limited, its structural features align with known fluoride transporters, with multiple transmembrane domains that create a pathway for ion movement across the bacterial membrane.

How does recombinant crcB3 differ from native protein expression?

Recombinant crcB3 protein is typically expressed with a His-tag fusion (N-terminal in commercially available forms) to facilitate purification and detection. This addition may slightly alter the protein's molecular weight and potentially its structural properties compared to the native form.

The recombinant version is commonly expressed in E. coli expression systems, which may result in different post-translational modifications compared to native expression in Brucella abortus. Researchers should consider that while the primary sequence remains identical to the native protein (aside from the tag), differences in folding environment and lack of Brucella-specific chaperones may affect tertiary structure .

What expression systems are optimal for producing recombinant crcB3?

The most commonly used expression system for recombinant crcB3 is E. coli. Available commercial preparations indicate successful expression using E. coli systems with N-terminal His-tagging. For researchers developing their own expression protocols, consider the following approaches:

  • Vector selection: pET-based expression vectors provide strong inducible expression suitable for membrane proteins

  • E. coli strain optimization: BL21(DE3) or Rosetta strains can accommodate the codon usage of Brucella genes

  • Induction conditions: Lower temperatures (16-20°C) during induction often improve proper folding of membrane proteins

  • Membrane protein solubilization: Detergent screening (DDM, LDAO, or C12E8) may be necessary for efficient extraction

While E. coli is the predominant system, more advanced research might explore alternative expression hosts such as cell-free systems for membrane proteins or Brucella-derived expression systems for native-like modifications .

What are the recommended methods for purifying recombinant crcB3?

Purification of recombinant His-tagged crcB3 requires specialized approaches due to its predicted membrane protein characteristics:

  • Initial capture: Immobilized metal affinity chromatography (IMAC) using Ni-NTA resin is effective for His-tagged crcB3

  • Buffer composition: Inclusion of appropriate detergents (0.05-0.1% DDM) is critical to maintain protein solubility

  • Secondary purification: Size exclusion chromatography helps separate monomeric from oligomeric forms and remove aggregates

  • Quality assessment: SDS-PAGE analysis typically shows >90% purity for properly purified preparations

Based on commercial preparations, the final product is often presented as a lyophilized powder, which requires proper reconstitution in Tris/PBS-based buffer (pH 8.0) containing 6% trehalose for stability. For long-term storage, the addition of 5-50% glycerol and aliquoting is recommended to prevent freeze-thaw cycles that can compromise protein integrity .

How can recombinant crcB3 be utilized in Brucella pathogenesis studies?

Recombinant crcB3 offers several research applications for investigating Brucella pathogenesis:

  • Antibody production: Purified recombinant crcB3 can be used to raise specific antibodies for immunolocalization studies within infected cells

  • Protein-protein interaction studies: Pull-down assays using His-tagged crcB3 may identify host factors interacting with this protein during infection

  • Functional characterization: Fluoride transport assays using proteoliposomes reconstituted with purified crcB3 can validate its predicted ion transport function

  • Structural studies: Purified protein can support crystallography or cryo-EM approaches to determine its 3D structure

Researchers investigating macrophage interactions can explore whether crcB3 plays a role in the NF-κB signaling pathway modulation observed during Brucella infection of macrophages, especially given the dynamic M1/M2 polarization patterns documented during infection progression .

What controls should be included when studying crcB3 protein interactions?

When designing experiments to study crcB3 protein interactions, researchers should implement the following controls:

  • Negative controls:

    • Empty vector-transformed E. coli lysates processed identically to crcB3-expressing samples

    • Unrelated His-tagged proteins (preferably of similar size and hydrophobicity) to control for tag-specific interactions

    • Heat-denatured crcB3 to distinguish specific from non-specific binding

  • Positive controls:

    • Known bacterial fluoride transporters (if available) to benchmark transport activity

    • Well-characterized membrane protein controls appropriate to the assay being performed

  • Validation approaches:

    • Competitive binding assays with unlabeled protein

    • Dose-dependent interaction studies

    • Mutational analysis of key residues predicted to be involved in function

The inclusion of these controls helps distinguish genuine biological interactions from experimental artifacts, particularly important when working with membrane proteins that may exhibit non-specific interactions due to their hydrophobic properties .

How does crcB3 contribute to B. abortus survival in macrophages?

While the specific role of crcB3 in macrophage survival has not been directly characterized, research on B. abortus infection provides context for potential functions:

B. abortus demonstrates a time-dependent modulation of macrophage polarization, transitioning from initially triggering M1 polarization (peaking at 12 hours post-infection) to eventually promoting M2 polarization. This phenotypic switch correlates with enhanced intracellular bacterial survival. The NF-κB signaling pathway plays a crucial role in this process, with inhibition of NF-κB promoting M2 polarization and increasing bacterial survival .

As a putative ion transporter, crcB3 may contribute to bacterial survival by:

  • Maintaining ionic homeostasis within the bacterium during intracellular stress

  • Potentially counteracting host defense mechanisms that might involve fluoride or other ion-based antimicrobial activity

  • Contributing to membrane integrity during intracellular replication phases

Future research using crcB3 knockout or knockdown approaches could elucidate its specific contribution to these survival mechanisms .

Can recombinant crcB3 be incorporated into subunit vaccine approaches?

Current vaccine development against B. abortus has focused on other immunogenic proteins, but recombinant crcB3 could potentially be evaluated as a vaccine component:

Recent research has demonstrated that a combined subunit vaccine (CSV) approach using four recombinant B. abortus proteins (ribosomal protein L7/L12, OMP22, OMP25, and OMP31) induces strong protective immunity against B. abortus infection in murine models. These vaccines elicited robust T-helper-1-dominated immune responses, characterized by:

  • Increased production of IFN-γ and IL-2

  • Low IL-10 production

  • Higher IgG2a titers compared to IgG1

  • Protection levels comparable to the RB51 vaccine strain

While crcB3 was not part of this specific vaccine formulation, researchers could investigate its potential by:

  • Evaluating crcB3 immunoreactivity with Brucella-positive sera

  • Determining its ability to stimulate T-cell responses in immunized animals

  • Testing its protective efficacy alone or in combination with known protective antigens

  • Assessing cross-protection potential against different Brucella species and biovars

How can transposon mutagenesis approaches be applied to study crcB3 function?

Transposon mutagenesis offers powerful approaches for studying crcB3 function in vivo:

Recent studies have utilized transposon mutant libraries with unique barcodes to track B. abortus population structures during infection. Similar approaches could be applied to investigate crcB3 function:

  • Site-directed transposon insertion: Targeted disruption of the crcB3 gene using transposon mutagenesis followed by phenotypic characterization

  • Conditional expression systems: Combining transposon mutagenesis with inducible promoters to control crcB3 expression timing

  • In vivo competition assays: Co-infection with wild-type and crcB3 mutant strains to assess fitness contributions in various infection stages

In bovine infection models, such approaches have revealed that B. abortus faces severe bottlenecks during host entry, with approximately 0.0001 probability of an individual bacterium successfully colonizing draining lymph nodes. Similar techniques could determine if crcB3 mutations affect this colonization efficiency .

What bioinformatic approaches are useful for predicting crcB3 structure-function relationships?

Advanced bioinformatic analyses can provide insights into crcB3 structure and function:

  • Structural modeling:

    • Homology modeling based on solved structures of related fluoride channels

    • Ab initio modeling of transmembrane topology

    • Molecular dynamics simulations to predict ion channel properties

  • Evolutionary analysis:

    • Comparative genomics across Brucella species and biovars to identify conserved regions

    • Selection pressure analysis to identify functionally critical residues

    • Phylogenetic analysis to understand evolutionary relationships with fluoride transporters in other bacteria

  • Protein-protein interaction predictions:

    • Coevolution analysis to identify potential interacting partners

    • Docking simulations with host proteins implicated in Brucella infection

These computational approaches can guide experimental design by identifying critical residues for mutagenesis, predicting potential regulatory mechanisms, and suggesting functional hypotheses for experimental validation .

What are common challenges in working with recombinant crcB3 and how can they be addressed?

Researchers working with recombinant crcB3 may encounter several technical challenges:

  • Protein solubility issues:

    • Challenge: As a membrane protein, crcB3 may aggregate during expression and purification

    • Solution: Optimize detergent type and concentration; consider fusion tags known to enhance solubility (SUMO, MBP); explore nanodiscs or amphipols for stabilization

  • Low expression yields:

    • Challenge: Membrane proteins often express poorly in heterologous systems

    • Solution: Test multiple E. coli strains; optimize codon usage; lower induction temperatures (16-20°C); consider auto-induction media

  • Protein activity assessment:

    • Challenge: Functional assays for fluoride transport are technically challenging

    • Solution: Develop liposome-based fluoride efflux assays using fluoride-sensitive probes; consider complementation approaches in fluoride-sensitive E. coli strains

  • Storage stability:

    • Challenge: Purified protein may lose activity during storage

    • Solution: Store in buffer containing 6% trehalose at pH 8.0; add glycerol (5-50%) for freezing; avoid repeated freeze-thaw cycles

What methodological approaches are recommended for studying crcB3 localization in Brucella cells?

Studying crcB3 subcellular localization requires specialized approaches for bacterial membrane proteins:

  • Immunolocalization techniques:

    • Generate specific antibodies against purified recombinant crcB3

    • Optimize fixation and permeabilization protocols for Brucella cells (typically 4% paraformaldehyde with detergent permeabilization)

    • Use super-resolution microscopy (STORM, PALM) for precise localization within the bacterial membrane

  • Fusion protein approaches:

    • Create translational fusions with fluorescent proteins (msfGFP or mCherry optimized for bacterial expression)

    • Validate that fusion proteins maintain normal localization and function

    • Use inducible promoters to control expression levels

  • Fractionation studies:

    • Develop protocols for clean separation of outer membrane, inner membrane, and cytoplasmic fractions

    • Confirm fractionation purity with marker proteins for each compartment

    • Detect crcB3 in fractions using western blotting with specific antibodies

These approaches should be integrated with functional assays to correlate localization patterns with protein activity and Brucella virulence phenotypes .

How does crcB3 research integrate with broader studies of Brucella-host interactions?

crcB3 research can be contextualized within the broader framework of Brucella pathogenesis:

Recent studies have revealed that B. abortus modulates macrophage polarization in a time-dependent manner, with NF-κB signaling playing a central role in controlling the switch between M1 and M2 phenotypes. This process involves the regulation of glutaminase (Gls) expression by NF-κB, creating a dynamic immune environment that eventually favors bacterial survival .

Future research integrating crcB3 could explore:

  • Whether crcB3-mediated ion transport affects the intracellular environment in ways that influence macrophage polarization

  • If crcB3 expression is regulated in response to the same environmental cues that trigger changes in macrophage phenotype

  • Potential interactions between crcB3 and components of the NF-κB signaling pathway or its downstream targets

The population structure studies revealing severe bottlenecks during bovine infection also provide a framework for investigating whether crcB3 function influences the probability of successful host colonization by individual bacteria .

What emerging technologies could advance our understanding of crcB3 function?

Several cutting-edge technologies hold promise for deeper characterization of crcB3:

  • Cryo-electron microscopy:

    • High-resolution structural determination of membrane-embedded crcB3

    • Visualization of conformational changes during ion transport

    • Structural basis for inhibitor binding

  • CRISPR-based approaches:

    • CRISPRi for conditional knockdown studies in Brucella

    • Base editing for precise mutation of key residues without complete gene disruption

    • CRISPR screening to identify genetic interactions with crcB3

  • Advanced imaging techniques:

    • Live cell imaging of fluorescently tagged crcB3 during infection

    • Correlative light and electron microscopy to relate protein localization to ultrastructural features

    • Single-molecule tracking to observe dynamic behavior in living bacteria

  • Systems biology integration:

    • Multi-omics approaches combining transcriptomics, proteomics, and metabolomics

    • Network analysis to position crcB3 within bacterial stress response pathways

    • Computational modeling of ion homeostasis during different infection stages

These technologies could provide unprecedented insights into crcB3 function and its role in Brucella pathogenesis, potentially identifying new therapeutic targets or vaccine components .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.