Recombinant Brucella abortus biovar 1 Putative peptide transport system permease protein BruAb2_1031 (BruAb2_1031)

Shipped with Ice Packs
In Stock

Description

Intracellular Survival Mechanisms

  • Immune Evasion: Mutation of BruAb2_1031 in B. abortus (C3 mutant strain) resulted in reduced cytokine responses (e.g., TNF-α, IL-12) and apoptosis in infected RAW 264.7 macrophages, enhancing bacterial survival .

  • Altered Antigenicity: Disruption of BruAb2_1031 perturbs bacterial envelope components, potentially reducing macrophage recognition and immune activation .

Experimental Validation

  • Intracellular Replication: The C3 mutant strain exhibited a 2.5-fold increase in intracellular survival compared to the wild-type strain at 6 hours post-infection .

  • Microarray Analysis: Infection with the mutant strain downregulated host genes associated with M1 macrophage polarization and oxidative burst .

Expression and Purification

  • Expression Systems: Optimized in E. coli with N-terminal His-tags for affinity chromatography .

  • Storage: Lyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -80°C .

Potential Applications

ApplicationRationale
Vaccine DevelopmentBruAb2_1031 mutation enhances survival, suggesting its role as a virulence factor and potential antigen .
Host-Pathogen Interaction StudiesUsed to elucidate mechanisms of immune evasion in Brucella infections .
Diagnostic Tool DevelopmentRecombinant protein serves as an antigen in ELISA-based assays .

Functional Insights from Mutant Studies

  • Transposon Mutagenesis: Insertional inactivation of BruAb2_1031 impaired peptide transport but paradoxically increased bacterial persistence in macrophages .

  • ABC Transporter Role: The protein is part of a system that imports dipeptides, which are essential for bacterial nutrition in nutrient-scarce intracellular environments .

Comparative Genomics

  • Conservation: BruAb2_1031 homologs are present across Brucella species (e.g., B. melitensis, B. suis), but regulatory elements differ, suggesting species-specific adaptations .

Challenges and Future Directions

  • Mechanistic Gaps: The exact substrates transported by BruAb2_1031 remain uncharacterized .

  • Therapeutic Potential: Further studies are needed to evaluate BruAb2_1031 as a vaccine candidate or drug target .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we can accommodate specific format requests. Please indicate your preferred format in the order notes, and we will fulfill your requirements.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for arrangements and additional fees.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
BruAb2_1031; Putative peptide transport system permease protein BruAb2_1031
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-314
Protein Length
full length protein
Species
Brucella abortus biovar 1 (strain 9-941)
Target Names
BruAb2_1031
Target Protein Sequence
MTALILKRVAQAIPVMLIVAILTFLLMKLLPGDPAILIAGDGASPETVERIRVELGLDQP TVVQLGQWLWNLFHFDLGRSFLLSQPVSQAIAERLPVTISLALLAFAITIPVGIIMGVVA AYLRDSWFDTGVMSLALLGVSVPSFWLAILAVILFSVTLGWFPSAGYVPFLDSPLGWLRS LILPASILALFQIGYLARMTRSEMLEVMDQDYIRTARSKGVSEYSVLSTHAFRNALVSVL TVSGYIFSLLIGGSVVIEQIFALPGLGRLLVQAILARDLPVVQGTMLFLGFLFVAINVLV DILYTIADPRVRYD
Uniprot No.

Target Background

Function
This protein likely forms part of an ABC transporter complex, potentially involved in peptide import. It is probable that it facilitates the translocation of substrates across the membrane.
Database Links
Protein Families
Binding-protein-dependent transport system permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is BruAb2_1031 and what is its function in Brucella abortus?

BruAb2_1031 is an ATP-binding cassette (ABC) transporter permease protein in Brucella abortus that functions primarily in dipeptide import across the bacterial membrane. As a component of the ABC transporter system, it plays a crucial role in bacterial nutrition by facilitating the uptake of peptides, which are essential for bacterial growth and replication. The ABC transporter systems typically consist of membrane-spanning domains (like BruAb2_1031) that form channels through which specific substrates can cross the membrane, along with ATP-binding domains that provide energy for this transport through ATP hydrolysis .

What experimental models are commonly used to study BruAb2_1031?

The most widely used experimental model for studying BruAb2_1031 is the RAW 264.7 mouse macrophage cell line infected with B. abortus wild-type and mutant strains. This cellular model provides valuable insights into host-pathogen interactions and the role of specific bacterial genes in infection. The mutant strains are typically generated using transposon mutagenesis, which is a genetic tool frequently employed to characterize genes of unknown function. After infection, researchers can assess various parameters including:

  • Bacterial intracellular survival and replication rates

  • Transcriptional responses in host cells using microarray analysis

  • Cytokine production by infected macrophages

  • Bacterial growth characteristics in culture media

  • Internalization efficiency of bacteria into host cells

How is the mutation of BruAb2_1031 confirmed in experimental studies?

Confirmation of mutation in the BruAb2_1031 gene is typically performed through a combination of molecular techniques. In studies where transposon mutagenesis is used to generate mutant strains, researchers confirm the mutation site through PCR amplification of the disrupted gene region followed by sequence analysis. The specific insertion site is then identified using BLASTIN analysis, which compares the obtained sequence with known genomic sequences of B. abortus. This process allows researchers to precisely locate the transposon insertion point within the BruAb2_1031 gene, confirming that this specific gene has been disrupted rather than other potential targets .

What are the basic growth characteristics of BruAb2_1031 mutant strains?

BruAb2_1031 mutant strains exhibit distinctive growth patterns that differ from wild-type B. abortus. Key characteristics include:

  • Slower growth rate in brucella broth culture medium

  • Altered replication kinetics within RAW 264.7 macrophage cells

  • Different colony morphology on solid media

  • Potentially modified nutrient utilization patterns

These growth differences likely result from impaired peptide uptake, as the BruAb2_1031 protein plays a critical role in transporting essential nutrients across the bacterial membrane. Considering the importance of peptide uptake in bacterial nutrition, especially for intracellular bacteria, mutation of this transport protein significantly impacts the growth and replication capabilities of B. abortus .

How does BruAb2_1031 compare to other ABC transporters in Brucella species?

BruAb2_1031 belongs to the broader family of ABC transporters found in Brucella and related bacterial species. Within the alpha subgroup of Proteobacteria, other notable ABC transporters include the ExsA protein of Rhizobium meliloti and Mesorhizobium loti. The ExsA in R. meliloti shares functional similarities with BruAb2_1031, as it also serves as a transport protein, specifically for exopolysaccharide succinoglycan (EPS I). This exopolysaccharide is essential for alfalfa root nodule invasion by R. meliloti, highlighting how ABC transporters can be critical for host-bacteria interactions across different bacterial species .

While ExsA in R. meliloti shows 69% identity with B. abortus ExsA, BruAb2_1031 has a distinct role in peptide transport. Both proteins contain characteristic ATP-binding motifs and the ABC signature domain features typical of ABC transporters. Ortholog group analysis has placed various B. abortus ABC transporters, including BruAb2_1031, in groups that are likely involved in bacterial pathogenesis .

How does mutation in BruAb2_1031 affect the intracellular survival of B. abortus?

Interestingly, studies have demonstrated that mutation in the BruAb2_1031 gene leads to enhanced intracellular survival of B. abortus in RAW 264.7 macrophage cells compared to the wild-type strain. This enhanced survival appears to be associated with specific transcriptional changes in the host cells after infection with the mutant strain. Specifically, the mutation results in down-regulation of genes associated with cytokine responses and apoptosis in the infected macrophages, creating a more permissive intracellular environment for bacterial survival .

What transcriptional changes occur in host cells infected with BruAb2_1031 mutant strains?

Infection of RAW 264.7 cells with BruAb2_1031 mutant strains induces distinct transcriptional changes compared to infection with wild-type B. abortus. Microarray analysis has revealed several key differences:

Response CategoryWild-type InfectionBruAb2_1031 Mutant Infection
Cytokine responsesNormal up-regulationSignificant down-regulation
Apoptosis-related genesNormal expressionDown-regulation
Immune response genesTypical inflammatory profileReduced inflammatory profile
Bacterial recognitionNormal patternAltered pattern

These transcriptional differences are not significantly affected by variations in intracellular bacterial load, suggesting they result specifically from the mutation in BruAb2_1031 rather than from differences in bacterial numbers. The down-regulation of protective immune response-related functions in macrophages infected with the mutant strain indicates that BruAb2_1031 may be involved in producing or transporting bacterial components that normally stimulate host immune responses .

What methodological approaches can be used to study the specific role of BruAb2_1031 in peptide transport?

Advanced methodological approaches to investigate the specific role of BruAb2_1031 in peptide transport include:

  • Complementation studies: Reintroducing the wild-type BruAb2_1031 gene into mutant strains to determine if normal function is restored.

  • Radiolabeled peptide uptake assays: Using isotope-labeled peptides to quantitatively measure transport across bacterial membranes in wild-type versus mutant strains.

  • Membrane vesicle transport assays: Isolating bacterial membrane vesicles containing either wild-type or mutant BruAb2_1031 to directly assess transport function in a controlled system.

  • Protein interaction studies: Using pull-down assays or two-hybrid systems to identify other components of the transport machinery that interact with BruAb2_1031.

  • Structural biology approaches: X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure of BruAb2_1031 and how mutations affect this structure.

  • Substrate specificity profiling: Testing transport of different peptides to determine the substrate range and preferences of BruAb2_1031 .

How can researchers leverage BruAb2_1031 for vaccine development against brucellosis?

The finding that mutation of BruAb2_1031 affects intracellular survival of B. abortus suggests potential applications for vaccine development. Several approaches could be considered:

  • Attenuated live vaccines: BruAb2_1031 mutant strains, despite showing enhanced survival in vitro, might be attenuated in their ability to cause disease in animal models due to nutritional deficiencies in vivo. These strains could potentially be developed as live attenuated vaccines.

  • Subunit vaccines: Recombinant BruAb2_1031 protein could be produced and used as an antigen in subunit vaccines. The protein's role in bacterial survival makes it a relevant target for inducing protective immunity.

  • DNA vaccines: Genetic immunization using BruAb2_1031 DNA constructs could induce both humoral and cellular immune responses against this bacterial component.

  • Epitope mapping: Identifying immunodominant epitopes within BruAb2_1031 that generate protective immune responses could lead to the development of epitope-based vaccines.

  • Adjuvant selection: Testing various adjuvants in combination with BruAb2_1031 antigens to enhance immune recognition and response.

For effective vaccine development, researchers need to understand the immunological responses to BruAb2_1031 and determine its potential to induce protection against B. abortus infection in animal models .

How does the function of BruAb2_1031 interrelate with virulence mechanisms in B. abortus?

The function of BruAb2_1031 as a peptide transporter interrelates with virulence mechanisms in B. abortus through several complex pathways:

  • Nutritional adaptation: BruAb2_1031 facilitates the acquisition of peptides, which are critical nutritional sources during intracellular infection when bacteria must survive in nutrient-restricted environments.

  • Immune modulation: The transport of specific peptides may affect the production or secretion of bacterial factors that interact with host immune system components. The observed down-regulation of immune responses in cells infected with BruAb2_1031 mutants suggests this protein indirectly influences immune recognition.

  • Stress resistance: Proper nutrient acquisition through BruAb2_1031 may enhance bacterial resistance to various stresses encountered within host cells, including oxidative stress and antimicrobial peptides.

  • Metabolic regulation: Peptide import affects bacterial metabolism, which in turn can influence the expression of virulence factors through metabolic signaling networks.

  • Surface antigen presentation: Mutation in BruAb2_1031 may alter bacterial surface properties, potentially changing how the bacteria are recognized by host cell receptors and immune components.

Understanding these interrelationships requires integrated approaches combining transcriptomics, proteomics, and metabolomics to map the networks connecting BruAb2_1031 function to virulence mechanisms .

What controls are essential when studying BruAb2_1031 mutant strains?

When designing experiments to study BruAb2_1031 mutant strains, several critical controls must be included:

  • Wild-type strain: The parent strain used to generate the mutant is essential as the primary comparison control.

  • Complemented mutant: A strain where the mutation has been complemented by reintroducing the wild-type gene is crucial to confirm that observed phenotypes are specifically due to the BruAb2_1031 mutation rather than polar effects or secondary mutations.

  • Growth curve comparisons: Since mutation in BruAb2_1031 affects growth rate, normalizing experimental conditions based on growth phase rather than absolute time is important.

  • Bacterial load controls: For infection experiments, initial bacterial loads should be carefully controlled and verified, with CFU counting at multiple time points to track intracellular survival accurately.

  • Mutants in related genes: Including mutants in other ABC transporter components can help distinguish between effects specific to BruAb2_1031 and those common to disruption of the ABC transporter system generally.

  • Host cell viability controls: Monitoring host cell viability throughout infection experiments is essential as differences in cytotoxicity between wild-type and mutant strains could confound interpretation of survival data .

How can researchers effectively produce and purify recombinant BruAb2_1031 for functional studies?

Effective production and purification of recombinant BruAb2_1031 for functional studies involves several methodological considerations:

  • Expression system selection: Because BruAb2_1031 is a membrane protein, specialized expression systems like the pMAL system (which creates fusion proteins with maltose-binding protein) may enhance solubility and facilitate purification. Alternative systems include those designed specifically for membrane proteins, such as cell-free expression systems.

  • Fusion tag strategies: Addition of fusion tags (His-tag, GST, MBP) can improve expression and purification, with MBP particularly useful for enhancing solubility of membrane proteins.

  • Detergent screening: Identifying optimal detergents for solubilization while maintaining protein function is critical for membrane proteins like BruAb2_1031.

  • Purification protocol: A multi-step purification protocol typically includes affinity chromatography based on the fusion tag, followed by size exclusion and/or ion exchange chromatography to achieve high purity.

  • Functional validation: Confirming that the purified protein retains its native conformation and functional properties through activity assays or binding studies.

  • Stability optimization: Determining buffer conditions that maximize protein stability during storage and experimental use .

What techniques can resolve contradictory findings about BruAb2_1031 function?

When researchers encounter contradictory findings regarding BruAb2_1031 function, several advanced techniques can help resolve these discrepancies:

  • Conditional knockout systems: Using inducible promoters to control BruAb2_1031 expression levels can help distinguish between primary effects of gene loss and compensatory adaptations that may occur in constitutive mutants.

  • Single-cell analysis techniques: Flow cytometry and single-cell RNA-seq can reveal heterogeneity in bacterial populations that might explain seemingly contradictory results from bulk population studies.

  • In vivo infection models: Moving beyond cell culture to animal models can provide context-dependent insights that resolve contradictions observed in simplified systems.

  • Multi-omics approaches: Integrating transcriptomics, proteomics, and metabolomics data can provide a more comprehensive view of how BruAb2_1031 mutation affects bacterial physiology.

  • Structural biology: Determining the three-dimensional structure of BruAb2_1031 and how mutations affect this structure can clarify functional implications.

  • Systematic review and meta-analysis: Analyzing experimental conditions, bacterial strains, and methodological differences across studies can often explain apparent contradictions in the literature .

How might systems biology approaches advance our understanding of BruAb2_1031 function?

Systems biology approaches offer powerful frameworks to comprehensively understand BruAb2_1031 function within the broader context of B. abortus biology:

What emerging technologies could enhance the study of BruAb2_1031 and other ABC transporters?

Several emerging technologies hold promise for advancing research on BruAb2_1031 and related ABC transporters:

  • CRISPR-Cas9 genome editing: Precise genetic manipulation to create specific mutations or regulatory modifications in BruAb2_1031 without polar effects.

  • Cryo-electron microscopy: High-resolution structural analysis of the entire ABC transporter complex, including BruAb2_1031, in its native membrane environment.

  • Single-molecule tracking: Visualizing the dynamics of individual BruAb2_1031 proteins in living bacteria to understand transport mechanisms in real-time.

  • Nanopore technology: Direct measurement of peptide transport through reconstituted BruAb2_1031 channels.

  • Microfluidics: Creating controlled microenvironments to study BruAb2_1031 function under precisely defined conditions that mimic those encountered during infection.

  • Synthetic biology approaches: Engineering artificial systems to isolate and study specific aspects of BruAb2_1031 function in simplified contexts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.